KEGG   Thermodesulfatator indicus: Thein_2089Help
Entry
Thein_2089        CDS       T01546                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00900  Terpenoid backbone biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thein_2089
Enzymes [BR:tid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Thein_2089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C NmrA Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEH45937
UniProt: F8ADC2
Position
complement(2164274..2165437)
Genome map
AA seq 387 aa AA seqDB search
MAKKIAILGSTGSIGRSTLEVVEAFPDRFKVVALTAGENIELLAKQAEKFKPLQVACKNE
YLAEKLKPLLPKGVKLLHGKEGIIACARHPEVESVVSALVGSAGLLPTFAAVEAGKTLAL
ANKESLVMAGKLLIEKARETGSQIIPVDSEHSAIFQALQAGRAQEVNKIILTASGGPFRE
RPKETFNKITPEEALKHPNWRMGPKITIDSATLMNKGLEVIEAHFLFNVPPEKIDVVIHP
QSIVHSLVEFVDGSVIAQLGVPDMRVPIAYALSYPERLPLPFPKLDLVKASPLTFEVPDL
EKFPCLALAYEALRLGGTAPAVLNAANEVAVEVFLEGRLRFDLIPEVIRETLVRADIKEP
SSIDEVINADIFARIIAHQIIDELEKD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaagatagcgattttgggttcaactggttcaatagggcgaagcacccttgag
gtggtagaggcctttcctgaccgttttaaggtcgtagctctaacggctggagaaaacatt
gaactcctggctaaacaggctgagaaattcaagcctttgcaggtggcctgcaaaaatgaa
tacctggcggaaaaattaaaaccccttttgcccaaaggcgtaaagcttctccacggaaaa
gaagggattatcgcctgtgccagacaccccgaagtggaaagcgtagtttcggcgttggtg
ggttcagctgggcttctccccacctttgccgcggtggaggcaggaaagactctggccctg
gccaacaaagagtccctggtaatggctggaaagctcctcatagaaaaggcccgagaaacc
ggtagccaaattatccctgttgacagcgaacattcggcaatttttcaggccttacaggcc
ggacgtgctcaagaagtcaataaaattattctcaccgcctctggtggaccgtttcgggaa
aggccaaaagagacttttaacaagataacgcctgaggaggccttaaaacatccgaactgg
cggatggggcctaaaattaccatagattcagctactcttatgaataaaggtcttgaggtc
atagaggcccactttctctttaatgtcccgcctgaaaaaatagatgtggttattcatccc
caaagcattgtccattctctggtggagtttgttgacggctcagttatagcccagcttggc
gtaccggacatgcgtgtgcccattgcttacgccctttcttatcctgaaaggctacctctg
ccctttccgaagcttgatttggttaaagcctcaccgcttacctttgaagtccctgacctt
gagaaatttccctgtctggccctggcttatgaggccctgcgcctgggaggcacggctccg
gcggtgttaaacgccgctaacgaagtcgccgttgaagtttttttagaaggaaggcttcgt
tttgacttaattcctgaggtgataagagaaactcttgtccgggcagatattaaagaacca
tcgtctatagatgaggtcataaatgccgatatatttgctagaattattgctcatcaaata
attgatgaactggagaaagattaa

DBGET integrated database retrieval system