KEGG   Thermodesulfatator indicus: Thein_2179Help
Entry
Thein_2179        CDS       T01546                                 

Definition
(GenBank) dihydropteroate synthase DHPS
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
tid  Thermodesulfatator indicus
Pathway
tid01100  Metabolic pathways
tid01120  Microbial metabolism in diverse environments
tid01200  Carbon metabolism
Brite
Enzymes [BR:tid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     Thein_2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD MtrH
Motif
Other DBs
NCBI-ProteinID: AEH46027
UniProt: F8AA14
Position
complement(2261064..2261960)
Genome map
AA seq 298 aa AA seqDB search
MSQTVVCIAESINIMGKRTGQAMRDRNPGPIQEMAKEETELGADYLDLNIGPAKKDGPDL
AAWIVKVVEEVVDTPISLDTTNPEAMIAGIKASKNPSRVLMNSISAQPERMEKLIPFAAE
VGCDVVALLWGPEGMPRDANERAAMAVDLIMALNEAGIPNEKIWVDPIGTPITLGADQIL
EGLNFLAMLPDIAPGCKSTIGLSNVSNGVPHHLRCYLDRVYLMMLMKYNIYSAILNIYDK
ELVEIAKGKHPDWVKLVHDMMDGDEPDPSKLSPKELEIYKTARVLLGKTIFSESWLEL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagacggtagtttgtattgcagagtctatcaacatcatggggaaacgtaccggc
caggccatgcgagatagaaaccccggccctatccaggagatggccaaggaagaaaccgaa
ctaggcgccgattaccttgacttaaacatcggcccggccaaaaaagacggcccggacctc
gccgcctggattgtcaaagtggtagaagaagtggttgacactcccatttcccttgacacc
accaaccctgaggccatgatcgccggcattaaggcctcaaagaatccctcgcgcgtgctc
atgaactctatctcggcccagcctgagcgtatggaaaagctaattccctttgctgcggaa
gtaggttgcgatgtcgtagcccttctctgggggccagagggtatgccacgagacgccaac
gagcgggcggccatggccgttgaccttatcatggccttaaacgaggccggtatccccaac
gaaaaaatctgggttgaccccatcggcacccccattacccttggggccgaccagattctt
gaaggtcttaatttccttgccatgcttccagatattgcgcctgggtgtaagagcaccata
gggctttcaaacgtatcaaacggagtaccgcatcacctgcgctgttatcttgaccgggtg
tatttgatgatgctcatgaagtacaacatttactcggcgattttgaacatttacgacaaa
gagctggtggagatagccaaaggcaagcatccagattgggtaaagttggtgcatgatatg
atggacggagacgagccggatccgagcaagctttcgcccaaggagcttgagatatacaag
acggcgagggtgcttcttgggaagaccatcttttctgaatcctggcttgaactttaa

DBGET integrated database retrieval system