KEGG   Thioploca ingrica: THII_0839Help
Entry
THII_0839         CDS       T03616                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tig  Thioploca ingrica
Pathway
tig00071  Fatty acid degradation
tig00280  Valine, leucine and isoleucine degradation
tig00310  Lysine degradation
tig00362  Benzoate degradation
tig00380  Tryptophan metabolism
tig00620  Pyruvate metabolism
tig00630  Glyoxylate and dicarboxylate metabolism
tig00640  Propanoate metabolism
tig00650  Butanoate metabolism
tig00900  Terpenoid backbone biosynthesis
tig01100  Metabolic pathways
tig01110  Biosynthesis of secondary metabolites
tig01120  Microbial metabolism in diverse environments
tig01130  Biosynthesis of antibiotics
tig01200  Carbon metabolism
tig01212  Fatty acid metabolism
tig02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THII_0839
   00630 Glyoxylate and dicarboxylate metabolism
    THII_0839
   00640 Propanoate metabolism
    THII_0839
   00650 Butanoate metabolism
    THII_0839
  09103 Lipid metabolism
   00071 Fatty acid degradation
    THII_0839
   00072 Synthesis and degradation of ketone bodies
    THII_0839
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    THII_0839
   00310 Lysine degradation
    THII_0839
   00380 Tryptophan metabolism
    THII_0839
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    THII_0839
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    THII_0839
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    THII_0839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tig04147]
    THII_0839
Enzymes [BR:tig01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     THII_0839
Exosome [BR:tig04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THII_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAP55136
UniProt: A0A090BUH9
Position
complement(1018332..1019513)
Genome map
AA seq 393 aa AA seqDB search
MEKVVIVAAARTAVGNFNGMLANFPASTLGAKVIAYLLQQTGLQPEQIDEVILGQVLAAG
VGQNPARQSAIAAGLPIEVPAMTINKVCGSGLKAVHLATQAIRCQDAEIIIAGGQENMSL
APHILPKSRQGMRMGEWVMPDSMVIDGLWDIFNNYHMGCTAENIVEKYGFTRKEQDEFAT
LSQQKAIAAQQAGYFDKQIVLIEIPQRKGEPLLFQVDEFPRPGTTVESLAKLRPAFNPAG
TVTAGNASGINDGAAAVMIMSESKAQALGLTPMARIVAYANAGVDPKIMGTGPIPATRKC
LQKAGWQIDELDLIEANEAFAAQAMAVNRELGWDLAKVNVNGGAIALGHPIGASGARILV
TLLHEMVRRNVHKGLATLCIGGGQGVALAVARE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagtggttattgtagccgctgctcgcaccgcagtaggtaattttaatggcatg
ttggctaactttccagccagtactttaggtgctaaagtgattgcttatttgttacaacaa
accgggttacaacccgagcagatcgatgaagtcatcttgggtcaagtattagccgctggt
gtaggccaaaatccagcccgtcaatctgcaatagccgctggtttaccaatagaagtaccg
gccatgacgattaacaaagtttgtggtagtggtttaaaagcggttcatctcgctacccaa
gcaattcgttgtcaagatgcggaaattatcattgcgggtggacaagagaatatgagtttg
gcgccccacattttacctaaatctcgccaaggaatgcgcatgggggaatgggtgatgcct
gatagcatggttattgatggtttgtgggatattttcaataattatcacatgggttgtact
gcagaaaatattgttgaaaaatacggatttactcgaaaagaacaagatgaatttgccacc
ttatcgcaacaaaaagcgatagcggctcaacaagccggttatttcgataagcagattgtt
ctgattgaaattccgcaacgcaaaggagagccattgttatttcaagtggatgaatttcct
cgtccgggtacgacagttgaatcgcttgctaaattgcgccccgcttttaatccggccggt
accgtaaccgcaggtaatgcttccggtattaatgatggcgctgccgctgttatgattatg
agcgaaagtaaagcgcaagcattaggattaacccccatggctcgtattgttgcttatgct
aatgcgggagtggatcccaaaattatgggcacgggaccaattcccgccacccgcaaatgt
ctccaaaaagccggctggcaaatagatgagttggatttaattgaagccaatgaagctttt
gctgcacaagccatggcagttaatcgagaattgggttgggatttagccaaagtcaatgtt
aatggtggtgcaattgcgctaggtcaccccattggtgcttctggtgcacgaatattagtg
acactattacatgaaatggtgcgtcgaaatgtccataaagggttagctactttgtgcatt
ggtggcgggcaaggagttgctttagcggtagccagagaatag

DBGET integrated database retrieval system