KEGG   Thioploca ingrica: THII_1889Help
Entry
THII_1889         CDS       T03616                                 

Definition
(GenBank) serine--pyruvate transaminase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
tig  Thioploca ingrica
Pathway
tig00250  Alanine, aspartate and glutamate metabolism
tig00260  Glycine, serine and threonine metabolism
tig00630  Glyoxylate and dicarboxylate metabolism
tig00680  Methane metabolism
tig01100  Metabolic pathways
tig01110  Biosynthesis of secondary metabolites
tig01120  Microbial metabolism in diverse environments
tig01130  Biosynthesis of antibiotics
tig01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THII_1889
  09102 Energy metabolism
   00680 Methane metabolism
    THII_1889
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THII_1889
   00260 Glycine, serine and threonine metabolism
    THII_1889
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tig01007]
    THII_1889
Enzymes [BR:tig01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     THII_1889
    2.6.1.45  serine---glyoxylate transaminase
     THII_1889
    2.6.1.51  serine---pyruvate transaminase
     THII_1889
Amino acid related enzymes [BR:tig01007]
 Aminotransferase (transaminase)
  Class V
   THII_1889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: BAP56186
UniProt: A0A090BV39
Position
complement(2261448..2262584)
Genome map
AA seq 378 aa AA seqDB search
MNITDIKSFIPPIRTLMGPGPSDVHPRVLQAMARPTIGHLDPAFIDMMDEIKVLLHYAFQ
TQNALTLPISAPGSAGMETCFVNLVEPGDKVIVCQNGVFGGRMKENVERTGGIAVVIADE
WGTAVDPNRLEDTLKAHPDTKIVAFVHAETSTGVKSDAKTLGEIAHRYHCITIVDAVTSL
GGIPLKVDEWQIDAIYSGSQKCLSCTPGLSPVSFNERAVEKIKQRQTKVQSWFLDLNLVM
GYWGSSAKRTYHHTAPINVLYGLHEALIMLKEEGLENAWARHERHYQALRQGIENLGLTF
KVKESERLPQLNAITVPAGIDEAEVRQRLLNEYHLEIGAGLGNLAGQIWRIGLMGYACNL
KNVWYCVEALKEILSKIK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatataacggatattaagtcatttattccgccgattcgcactttaatgggaccggga
ccgtctgatgttcatcccagagttttacaagcgatggcacgtcccacgattggccattta
gatcccgcttttatcgacatgatggacgaaattaaggttttgttacattatgcttttcaa
actcaaaatgctttaactcttcccatttcggcacccggttctgctggaatggagacctgt
tttgttaatttagtagaacccggtgataaagtcattgtttgccaaaatggggtgtttggt
ggacggatgaaagaaaatgtggaacgaactggtggtattgccgtcgttattgcagatgaa
tggggaaccgcggttgatcccaatcgcctagaagatacgctaaaagcacatccagatacg
aaaattgtcgcttttgtccatgcagaaacgtctacgggtgttaaatcggatgctaaaacg
ttaggtgaaattgcgcaccgctatcattgtattacgattgttgatgccgtgacttcatta
ggtggaatcccactcaaagtcgatgaatggcaaattgatgcgatttattcaggctcacaa
aaatgtttatcttgcacgccgggtttatccccggtcagttttaacgaacgggcggttgag
aaaattaaacagcggcaaactaaagtccagagttggtttcttgacttgaatttagtcatg
ggttattggggtagtagtgctaaacgaacttatcaccacacggcacccattaatgttctt
tatggactccacgaagccttaatcatgctgaaagaagaaggtttagaaaatgcgtgggca
cgacatgaacgacattaccaagcattgcgtcaaggtattgagaacttggggctcactttt
aaagtcaaagaatctgaacggttgccacaactcaatgcgatcacggtaccggcaggaata
gatgaagccgaagtaagacaacgattactcaacgaataccatttagaaattggcgcgggc
ttgggcaacctcgctggtcaaatttggcggattggtttaatggggtatgcttgtaatctg
aaaaatgtttggtattgtgtggaagctttaaaagaaattctcagcaaaattaaatag

DBGET integrated database retrieval system