KEGG   Thioploca ingrica: THII_3057Help
Entry
THII_3057         CDS       T03616                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
tig  Thioploca ingrica
Pathway
tig00051  Fructose and mannose metabolism
tig00520  Amino sugar and nucleotide sugar metabolism
tig01100  Metabolic pathways
tig01110  Biosynthesis of secondary metabolites
tig01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tig00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    THII_3057
   00520 Amino sugar and nucleotide sugar metabolism
    THII_3057
Enzymes [BR:tig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     THII_3057
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     THII_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAP57354
UniProt: A0A090AIY2
Position
3673672..3675084
Genome map
AA seq 470 aa AA seqDB search
MLTPVILSGGSGSRLWPLSREHYPKQLLALIGEDTLLQATVKRLIGLPGQSAPLMVCNET
HRFLVAEQLRRIGVSPSHIILEPIGRNTAPATAIAALISMSYHPETLLLILPADHLIAQV
ETFQNAVKAGIPLAQAGYLVTFGVVPTHPETGYGYINARESIEDTVVLSVDRFVEKPDFE
TAKQYVDSGEYYWNSGMFLFKASRYLEELEKFAPDIVGACRQAIDNALEDKDFLRLDPAA
FKACPSNSIDYAVMEHTHAAAVVPLDAGWNDVGAWSSLWEVSEQDSDGNVIIGDVLVENV
RNCYLRADNRLLAAIGIEDHIIVETADAILVVHKDQVQSVKNIVSRLKAADRPEAHLHRK
VYRPWGSYEGIDNESRFQVKHITVNPGASLSLQMHYHRSEHWVVVKGTAQITRGEDTFIL
SENQSTYIPLGVKHRLANPGKLPLEIIEIQSGSYLGEDDIVRYEDVYGRE
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgttaactcctgtcattttatctggcggttctggcagccgcctctggccattatctcgt
gaacattatcccaaacaattattagctttaattggcgaagataccttattgcaggcgaca
gttaaacgccttattggcttaccgggtcaatcggctcctttgatggtttgtaatgaaacg
catcgttttctggtagcggaacaattgcgtcgaattggcgtttctcctagtcatatcatt
ttggaacccatcggacgtaataccgcaccggcaaccgcaatagccgctttgatatcaatg
agttatcacccggagaccttattgttgatattaccggctgatcatctaattgctcaggtt
gaaacctttcagaatgcggtcaaagcgggtattccattagctcaagcgggttatttagtg
acttttggggtggtacccactcatcccgaaacggggtatggttatattaatgcgcgggag
tcgatagaagatactgtcgttttatcggtagatcgctttgtggaaaaaccagattttgaa
accgctaaacaatatgttgattccggtgaatattattggaatagtgggatgtttttgttt
aaagccagccgctatttagaagaattagaaaaatttgctcccgatattgtgggtgcttgt
cggcaagcgattgataatgctttagaagataaagattttttacgtttagatcccgctgct
tttaaggcttgtccgagcaactccattgactatgccgtgatggaacacactcatgctgcg
gccgtggttcctttggacgctggttggaatgatgtcggtgcttggtcgtctctctgggaa
gtgagtgaacaagatagcgatggtaatgtgattatcggtgatgtgttggtggaaaatgtc
cgtaattgttatttacgcgccgacaaccggttactcgctgccattggcatcgaagatcac
atcattgttgaaaccgctgatgccattctagtcgttcacaaagatcaagttcaatcggtc
aaaaatattgtctcgcgcttaaaagcggctgatcgcccagaagcccatttacatcgtaaa
gtctatcgaccttggggtagttatgaagggattgataatgaatcccgctttcaggtcaag
cacatcaccgtgaatcccggggccagtttatccttgcaaatgcattatcatcgttctgaa
cactgggtagtggttaaagggactgctcaaattacccgcggtgaggacacttttatttta
tctgaaaatcaatcaacctatattccgttgggtgttaaacatcgtctcgctaatccaggt
aaattgcctttagagattattgaaatccaatccggtagttatttaggtgaagatgatatt
gtccgttatgaagatgtttatgggcgagaataa

DBGET integrated database retrieval system