KEGG   Thalassospira indica: DY252_03915Help
Entry
DY252_03915       CDS       T05581                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
tii  Thalassospira indica
Pathway
tii00020  Citrate cycle (TCA cycle)
tii00620  Pyruvate metabolism
tii01100  Metabolic pathways
tii01120  Microbial metabolism in diverse environments
tii01200  Carbon metabolism
tii01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DY252_03915
   00620 Pyruvate metabolism
    DY252_03915
Enzymes [BR:tii01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     DY252_03915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 ATP-grasp Dala_Dala_lig_C HlyD_D23 ATP-grasp_3 DUF2118 DUF1989
Motif
Other DBs
NCBI-ProteinID: AXO13449
Position
798493..801963
Genome map
AA seq 1156 aa AA seqDB search
MTRSAPKRIRKLMVANRGEIAIRVLRAANELGIRTVAIFSDEDRFALHRFKADESYTVGK
GNKPIRAYLDIEDILRVARDADVDAIHPGYGFLSENPEFADACAEAGIQFIGPDSEVMRT
LGNKVSARNLAESAGVPVMPASSALPEDMAEVTRIAEKIGYPLMLKASWGGGGRGMRVIE
NGKDLSGQVLAARREAEAAFGNGEVYFEKLIRRARHVEVQLLGDNHGTLVHLYERDCSVQ
RRNQKVVERAPAPYLDDDQRAEICDAAIRLGKAANYVNAGTVEFLMDVDTSKFYFIEVNP
RIQVEHTVTECVTGFDLVKAQILIAQGGRIGFPSETGIPWQDKIKLRDHALQCRITTENP
ENNFVPDYGIIKVYRGANGFGIRLDGGTAYSGAVITPFYDSMLEKVTAWGSTPREAVDRM
DRALREFRIRGVATNLAFLENLINHPKFRAGEYTTRFIDETPDLFKFVRRRDRATRLLRF
IGEVAVNGNPEVEGRVVPTNLHDPVMPKSIDLGEIRPGTKQKLDQLGPEGFSRWMKDQER
VLMTDTTMRDAHQSLLATRMRTYDMLEIAPYYAHGLPELFSIECWGGATFDVAMRFLKED
PWDRLVKLRERVPNILTQMLLRASNAVGYTNYPDNAVDYFVKQAAEHGMDVFRVFDSLNW
VENMKVAMESVLKTDKLCEATICYTGDIYDKDRPKYNLDYYVNMARELETAGAHILGLKD
MAGVLRPAAATELITALKDTVNIPIHFHTHDTSGISAATVIAAIDAGVDAVDAAMDSMSG
LTSQPNLGSIANNYIGQPRDPGLKTEALKEISTYWEQIRRYYAGFESDIRSGTSDVYVHE
MPGGQYTNLRQQARALGIEDRWPEVSKAYAAVNKMFGDVVKVTPSSKVVGDMALMMVTSG
LSEEDVLDPKKDITFPDSVISFFRGEIGQPVGGFPPALQRKVLKGAEALTDRPGKSLPPI
DFEATRKEIEKKTHRSNISDAEVASYVMYPKVFLDYAEHRSHNADVSVLPTPVFFYGMNQ
NDEISVDLEKGKTLVIRYLTTSEAGDEEGNRTVFFELNGQPRTVKVADKTLAGTGKTKPK
AEDGNKLHVAAPMPGLVVEVHVSEGQKIKSGDVMCSLEAMKMETAVHAEKDGTVAKIHAP
AGTQVEAKDLLVELTE
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgttcagcaccaaagcgtatccgtaaacttatggtcgccaaccgtggcgagatt
gcgattcgtgttctgcgagccgccaacgaacttggcattcgcacagttgcgatcttctct
gacgaggaccgcttcgcccttcaccgtttcaaggcggatgaaagctacacggtgggcaag
ggcaacaagcccattcgcgcctatcttgatatcgaagacatcctgcgtgtcgcgcgcgat
gccgatgtcgatgccatccatccgggttacggcttcctgtcggaaaatcccgaattcgcc
gatgcctgtgccgaggccggcattcaattcatcggcccggattccgaagtcatgcgcacc
cttggcaacaaggtctctgcgcgtaatctggccgaaagtgccggtgtgccggtcatgccg
gcttcaagcgcgctgcccgaagacatggccgaggtcacccgcatcgccgagaaaatcggc
tatcccctgatgctcaaagccagctggggcggcggtggccgtggcatgcgggttatcgaa
aatggcaaggacctgtctggtcaggtgctggctgccaggcgcgaggctgaggccgccttt
ggcaatggcgaggtttactttgaaaaactgatccgccgcgcccgccatgtcgaggtacag
ctcctgggcgataaccacggtactcttgtgcatctttatgaacgcgactgttcggttcag
cgccgcaaccagaaagtggtcgaacgcgctcccgcaccctatctcgatgatgatcagcgc
gccgagatttgtgacgctgcgatccgtcttggcaaggccgccaattacgtcaatgccggc
acggtcgagttcctgatggatgtcgacacatccaagttttacttcatcgaggtcaacccg
cgtattcaggtcgaacacaccgtcaccgaatgtgtgactggctttgatttggtcaaggca
cagatcctgatcgcacagggtggtcgcatcggtttcccgtccgaaaccggtatcccctgg
caggataaaatcaagctgcgcgatcatgcgcttcaatgtcgtatcaccaccgaaaacccg
gaaaacaactttgtccccgattacgggatcatcaaggtctatcgcggggccaacgggttt
ggcattcgtctggatggcggcacggcttactcgggtgctgtgatcacgccgttttatgac
agtatgcttgaaaaggtcaccgcatggggcagtaccccgcgcgaggcggtggaccgtatg
gaccgcgcattgcgtgaattccgaattcgcggtgttgccaccaacctggccttccttgaa
aacctgatcaatcacccgaaattccgggctggcgaatacaccacgcggtttattgatgaa
acgcccgatctgttcaagttcgtgcgccggcgcgaccgtgccacccgcctgctgcgcttc
atcggcgaggttgcggtcaatggcaatccagaggtcgaaggccgcgtggtgccgaccaat
ctgcatgatccggtgatgccaaagtccatcgaccttggcgaaatccgcccggggaccaag
caaaagcttgatcagttggggccggaaggtttctcgcgctggatgaaggatcaggaacgc
gtcctgatgaccgacaccaccatgcgtgatgcccatcagtcgcttctggccacccgcatg
cgcacctatgacatgctcgaaattgcgccttattacgcgcatggcttgccggaactgttt
tccattgaatgctggggcggggcaacctttgatgttgccatgcgcttcctcaaggaagat
ccgtgggatcgtctggtcaagctgcgcgaacgcgtgcccaatattcttacgcaaatgctg
ctgcgggcctccaacgcggttggctataccaactatcccgataatgcggtcgattacttc
gtcaagcaggcggccgaacacggcatggatgtcttccgcgtgtttgatagcctcaactgg
gttgaaaacatgaaggtcgcgatggaatcggtgcttaaaaccgacaagctttgcgaagcg
accatctgctacaccggcgatatctatgacaaggaccgcccgaaatataaccttgattac
tatgtgaatatggcccgcgaacttgaaactgccggtgcccatattctcggtctcaaggac
atggcgggtgtcctgcgtccagccgcggcgaccgagctgatcacggcccttaaggacacc
gtcaatatcccgatccatttccatacccacgacacaagcggtatttcggcggccaccgtg
attgccgcgattgatgccggggtcgatgcggtcgatgcggcaatggattcgatgtcgggc
ctgacatctcagcccaacctcggatcaatcgccaacaactatatcgggcagccacgcgac
ccgggccttaagaccgaggcgctcaaggaaatctcgacctattgggaacagatccgtcgc
tattacgcaggctttgaaagcgacatccgcagtggcacctccgacgtctatgtccacgaa
atgccgggcggccagtacaccaacctgcgccaacaggcccgtgcactcgggatcgaggat
cgctggcccgaagtgtccaaggcctatgccgcggtcaacaagatgtttggcgatgtcgtc
aaggtaacgccaagctccaaggttgttggcgatatggctttgatgatggtgacatccggt
ttgtccgaggaagacgttcttgatcctaaaaaggacattaccttccccgacagcgtcatt
tccttcttccgtggtgaaatcggtcagccggtcggtggcttcccgcccgccctgcagcgc
aaggtgctgaaaggtgccgaggcgctgacagaccgtccgggcaaatcattgccgccgatt
gatttcgaagcgacccgcaaggaaatcgaaaagaaaacccatcgcagcaatatctctgac
gccgaggttgcatcttatgtgatgtatcccaaggtgttccttgattacgccgaacaccgc
agccacaacgccgatgtttcggttctgccaaccccggtcttcttctacgggatgaaccag
aacgatgaaatttcggtcgatcttgaaaagggcaaaacccttgtcatccgctatctgacc
acgtccgaggccggtgacgaggagggcaaccgcaccgtgttctttgaactcaacggtcag
ccccgcaccgtcaaggtcgccgacaagacactggcgggcacgggcaagacaaaaccaaag
gccgaagatggcaacaagctgcacgttgcagcaccgatgccaggccttgtggtcgaagtc
cacgtgtccgaaggccagaagatcaagtcgggtgatgtgatgtgctcgctcgaagccatg
aaaatggaaaccgcggttcacgccgaaaaggatggaaccgtggccaaaatccacgccccg
gccgggacacaggtcgaagccaaggacctgctggtcgaattaacggagtaa

DBGET integrated database retrieval system