KEGG   Thalassospira indica: DY252_05305Help
Entry
DY252_05305       CDS       T05581                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
tii  Thalassospira indica
Pathway
tii00540  Lipopolysaccharide biosynthesis
tii01100  Metabolic pathways
Module
tii_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DY252_05305 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:tii01005]
    DY252_05305 (rfaD)
Enzymes [BR:tii01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     DY252_05305 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:tii01005]
 Unusual sugar
  DY252_05305 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR Sacchrp_dh_NADP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AXO13703
Position
1101162..1102148
Genome map
AA seq 328 aa AA seqDB search
MLIVTGGAGFIGSNIVAALEERGETDIVVVDRLRDGIKWKNIAKRNLRDIVHPDELPHFL
EEHAGNVEAIFHMGAISATTETDADKIVVNNLKLTAWLWEWCSRHSSRLIYASSAATYGD
GKQGFDDSFDDADLAKLAPLNAYGWSKHATDRRFRRILDQNGFRPKQWAGLKFFNVYGPN
EYHKGGMRSVVSQLFDKLSNGETATLFKSHHPDYEDGGQLRDFVWVGDVVDIIMWLYDNP
QVSDLFNIGTGKARSFKDLALAVFSAMGKEPDIKFVPTPEAIRDKYQYFTEANMTKLREA
GYGKEMTSLEEGVRSYVQDYLATEDPFR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcgtcactggtggtgccggatttatcggttccaatattgttgctgcccttgaa
gagcgtggcgaaaccgacattgttgtcgttgatcgcctgcgcgatggcatcaaatggaaa
aacatcgccaagcggaacctgcgtgacattgttcatcccgatgaactgccgcatttcctt
gaagagcatgccggcaatgtcgaggcgattttccatatgggcgcgatttccgcgaccacg
gaaaccgatgccgacaagatcgtcgtcaacaacttgaaactgacggcctggctttgggaa
tggtgttcgcgccactcatcgcgcctgatttatgcatcctcggcggcaacctacggcgat
ggcaagcagggctttgatgacagctttgatgacgccgatctggcgaaactggcaccgctg
aatgcctatggctggtccaagcatgcaactgatcgccggttccgccgtatcctcgatcag
aacggtttccggcccaaacagtgggcggggcttaagttctttaacgtctatggcccgaac
gagtaccataagggcggcatgcgatccgtggtgtcgcagctgtttgacaagctttcaaac
ggcgagaccgcgaccctgtttaaatcgcatcatcccgattacgaagatggcggccagttg
cgtgatttcgtctgggtcggtgatgtggtcgacatcatcatgtggctttatgacaacccg
caggtcagcgatcttttcaatatcggcaccggcaaggcgcgcagtttcaaggatctggca
ctggcagtgtttagcgccatgggcaaggagcccgatatcaagttcgtgccaacgcctgag
gcgatccgcgacaagtaccagtatttcaccgaagccaatatgaccaagctgcgcgaagcg
ggctatggcaaggaaatgacatcgcttgaagaaggcgtgcggtcctatgtgcaggattat
cttgcgaccgaggatccgttccgctga

DBGET integrated database retrieval system