KEGG   Thalassospira indica: DY252_06475Help
Entry
DY252_06475       CDS       T05581                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
tii  Thalassospira indica
Pathway
tii00471  D-Glutamine and D-glutamate metabolism
tii00550  Peptidoglycan biosynthesis
tii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    DY252_06475
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DY252_06475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tii01011]
    DY252_06475
Enzymes [BR:tii01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     DY252_06475
Peptidoglycan biosynthesis and degradation proteins [BR:tii01011]
 Precursor biosynthesis
  Amino acid ligase
   DY252_06475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AXO13910
Position
complement(1362278..1363684)
Genome map
AA seq 468 aa AA seqDB search
MIDLSHLSGKTIAVLGLGKSGLASVKALINAGAIVWAWDDNASSREQLEPLGLAPINLAE
CDWTEPDMLVISPGIPSTFPTPHPAAEKARRAGKPIICDVELLCVAQPDVPTLAITGTNG
KSTTTALTAHIIGQAGIKTQAGGNLGNAALGLEPSTADDCLVLELSSYQLELLEHAAFDA
CALLNITPDHLDRHGGLDGYIGAKHLIFARAKGPKWAIISVDDEPCAKMAVELAREGGRH
IIEVSVKQPVDHGIYVDDQGWLIDDMTGAQTRILDLATVTHMPGQHNWQNIAFAYGLCRA
RDVDATRIIDGIMSFPGLAHRQELLGTINGVVFVNDSKATNAEASAKALSAYHNIYWIAG
GKPKEGGIDGLQEFYPHIKKAYLIGAATNEFAETLGDDLPWEKCETLDVATKMAFADAKA
SGDDKPVVMLTPACASFDQFKSFEARGDAFRNLYNALAGGEMTRKANA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgattgatctttcacatctgagcggcaaaaccatcgcggttctgggtcttgggaaatcc
ggacttgccagtgtgaaggcattgatcaatgcaggtgccatcgtctgggcgtgggatgac
aacgcatcatcgcgtgaacagcttgaaccgcttggccttgcgccgatcaatctggcggaa
tgtgactggacagaacccgacatgctggtgatcagcccgggtattccgtccaccttcccg
accccgcatccggcggctgaaaaggcacgccgtgcgggcaaaccgatcatttgcgacgtc
gagttgctttgtgtggcgcagcctgatgtgcccacacttgccatcaccggcaccaacggc
aagtcaaccaccacagcactgaccgcccacatcatcgggcaggcagggatcaagacgcag
gcgggcggcaaccttggtaacgcagcccttgggcttgaaccctccaccgccgatgattgt
ctggtgcttgagctgtcatcctatcagcttgaactactggaacatgcggcctttgatgcc
tgcgcgctgttgaacatcacgccggatcatctggatcgccatggcggactggatggctat
atcggcgccaagcacctgatctttgcccgtgcaaaaggtccgaaatgggcgatcatttcc
gttgatgacgagccatgtgcaaaaatggcggttgaactggcccgtgaaggcggtcggcac
atcatcgaggtttccgtcaagcaaccggtcgatcacggcatctatgtggacgatcagggc
tggctgattgatgacatgaccggtgcgcaaacccgtattctggatcttgcgacagtcacc
cacatgcccggacaacacaactggcaaaacattgcctttgcctatggcttgtgccgcgca
cgtgatgtggatgccacccggatcattgacgggatcatgtccttcccgggtctggctcat
cgacaggaactgctgggcaccattaacggcgtcgtgtttgtcaatgacagcaaggccacc
aatgccgaggcatcggcaaaggcgctttcggcctatcacaacatctactggattgccggt
ggcaaacccaaggaaggcggaattgatggattgcaggaattctatccccacatcaagaaa
gcctatctgatcggtgccgcgaccaacgaatttgccgaaacccttggtgatgatctgcca
tgggagaaatgcgaaacccttgatgtcgcaaccaaaatggcctttgcagatgccaaggcc
agcggcgatgacaaaccggtggtgatgctcaccccggcctgcgcatcgtttgatcagttc
aaaagctttgaggcgcgcggcgacgccttccgcaatttgtacaacgcattagcgggtggt
gaaatgaccaggaaggcaaacgcatga

DBGET integrated database retrieval system