KEGG   Thalassospira indica: DY252_08995Help
Entry
DY252_08995       CDS       T05581                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
tii  Thalassospira indica
Pathway
tii03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tii00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DY252_08995
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tii03011]
    DY252_08995
Ribosome [BR:tii03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DY252_08995
  Bacteria
    DY252_08995
  Archaea
    DY252_08995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TRAPPC9-Trs120 Ph1570
Motif
Other DBs
NCBI-ProteinID: AXO14342
Position
1901999..1902379
Genome map
AA seq 126 aa AA seqDB search
MGKKADIRRLADNEAAASLRAVRISPRKLNLVAESIRGMKAEAALAELTFSNKRISQDVK
KLLESAIANAENNHQLDVDRLYIKEASVGKAFVMKRWRARARGRVGKIIKPFSNMRIVVC
EREEAE
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaagctgacatccgtcggctggcggataacgaggccgcggcttcgctccgg
gcagtacgcatttccccgcgtaagctcaacctcgtcgccgagtcgattcgtggtatgaag
gcagaagctgctttggcagagctgaccttctccaataaacgcatttcgcaagacgtcaaa
aagctgctggaatcggcaatcgctaatgccgaaaacaaccatcagctcgatgttgaccgt
ctctatattaaagaggcatctgttggtaaggccttcgtaatgaagcgctggcgcgcccgt
gcacgcggtcgtgttggcaaaatcattaagccgttctccaacatgcgcatcgtcgtttgc
gaacgtgaggaggccgagtaa

DBGET integrated database retrieval system