KEGG   Thalassospira indica: DY252_12435Help
Entry
DY252_12435       CDS       T05581                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tii  Thalassospira indica
Pathway
tii00450  Selenocompound metabolism
tii00970  Aminoacyl-tRNA biosynthesis
tii01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tii00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DY252_12435
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DY252_12435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tii01007]
    DY252_12435
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tii03016]
    DY252_12435
Enzymes [BR:tii01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DY252_12435
Amino acid related enzymes [BR:tii01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DY252_12435
Transfer RNA biogenesis [BR:tii03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DY252_12435
 Prokaryotic type
   Other AARSs
    DY252_12435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f GBP_C
Motif
Other DBs
NCBI-ProteinID: AXO16869
Position
2606145..2607710
Genome map
AA seq 521 aa AA seqDB search
MTGHKQPYYITTPIYYVNDKPHIGHAYTTLACDVLARFKRLDGYDVMFLTGTDEHGQKVD
KSAAAKGIAPQAFTDQVSQNFRDLAVHMNYSNDDFIRTTEERHKKACQALWNTLLEKGEI
YLGSYDGWYSVRDEAFYGEKELIEKDGEKLAPTGAPVEWVSEPSYFFKLSAWGDRLLEFY
EQNPDFIAPQSRRNEVISFVKGGMHDLSVSRTSFKWGVPVPGDEDHVMYVWLDALTNYLT
AIGYPDADPAKLEKYWPADLHMVGKDILRFHAVYWPAFLLAAGITPPKRVFAHGWWTNEG
QKISKSIGNVIDPYDLTDKYGLDQTRYFLMREVPFGNDGDFSHRSMVNRMNSELANDLGN
MCQRVLSMIHKNCNAAIPTPGEFTDADKEILAKAHGMLDTVRPLFDEQAFNKGLEAIWSL
VGDANRYVDEMAPWGLKKTDPARMETVLYVLAEVIRHVGILVQPIMPDSAAKILDQLVLG
DDQRGFDALGPDNALKPGSDIPKPAGVFPRYVETEDEGEKA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggcacaaacagccctattacatcacgacaccgatctattacgtcaacgacaag
ccccatatcggccatgcctataccacgcttgcctgcgacgttctggcccgcttcaagcgc
ctggacggttatgacgtgatgttcctgaccggaaccgatgaacacggtcaaaaggtcgac
aaatcggccgcagccaagggcattgccccgcaggcgttcacagaccaggtatcgcagaac
ttccgcgatcttgccgttcacatgaactattccaacgatgacttcatccgcaccactgaa
gaacgtcacaaaaaggcctgtcaggcgctttggaatacactattggaaaagggcgagatc
tatcttggctcctatgatggctggtattcggtccgtgacgaggcgttctacggcgagaag
gaactgatcgaaaaagacggcgaaaaactcgccccaaccggcgcaccggtggagtgggtg
tctgaaccgagttatttcttcaagttgtctgcttggggcgaccgcctgctggaattctac
gaacagaacccggacttcatcgcaccgcaatcacgccgtaacgaagtgattagctttgtg
aagggtggcatgcatgatctttccgtatcgcgcaccagcttcaaatggggcgttccggtg
ccaggggacgaagaccacgtcatgtatgtctggctcgatgcgctgaccaactatctgacc
gcgatcggttacccggatgcagatccggccaaacttgaaaagtactggcccgctgacctg
catatggtcggcaaggatatcctgcgtttccatgctgtttactggcccgcattccttctg
gctgcgggtatcacaccacccaagcgcgtctttgcccacggctggtggaccaacgaaggc
cagaaaatctccaaatcgatcggtaatgtgattgatccgtatgacctgaccgataaatac
ggtctggatcagacgcgttattttctgatgcgtgaagtgccgtttggcaatgatggtgac
ttttcccatcgttccatggtcaaccgcatgaacagcgaactggccaatgatcttggcaat
atgtgccagcgtgttctgtcgatgatccacaagaactgtaatgctgcgatcccgaccccg
ggcgagtttactgacgcggacaaggaaatcctcgccaaggcacacggcatgctcgatacc
gtgcgtccgctctttgacgagcaggcgttcaacaaggggctggaagcgatctggagcctt
gtgggtgatgccaaccgctatgtcgatgaaatggcgccttggggcctgaaaaagaccgat
ccggcgcgcatggagacggttttgtacgtcctggccgaggtcattcgccacgtcggcatc
cttgttcaaccaatcatgccggactcggcggccaaaatccttgatcagctggtgctgggc
gatgatcagcgcggatttgacgcgcttggcccggacaatgccctgaaaccggggtcggac
attccgaaaccggctggcgttttcccgcgctatgtagagaccgaggatgaaggagagaag
gcatga

DBGET integrated database retrieval system