KEGG   Thalassospira indica: DY252_21515Help
Entry
DY252_21515       CDS       T05581                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
tii  Thalassospira indica
Brite
KEGG Orthology (KO) [BR:tii00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DY252_21515 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354 Cadherin_4
Motif
Other DBs
NCBI-ProteinID: AXO17043
Position
complement(4561193..4561585)
Genome map
AA seq 130 aa AA seqDB search
MYSTVTHDIKVSVKPMFLEDESDPDTHRYIWAYRIEIENLGSKTVQLLNRHWRITDSRGE
TQEVKGPGVVGEQPVLACGESFNYTSGAPLTTPSGFMVGTFEMTDMDGNHFDIAIPAFSL
DSPHGQHTVN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtattcgaccgtaacccacgacatcaaggtatcggtaaaaccgatgttccttgaggac
gaatcagacccggacacccatcgttacatttgggcttatcgcatcgagatcgagaatctc
ggatcgaaaactgttcagttgcttaaccgtcactggcggattacggattcgcgtggcgaa
acccaagaagtcaaaggcccgggtgttgtcggcgaacagcctgttttggcctgcggcgaa
agtttcaactacaccagtggcgcgccactgaccacgccaagcggcttcatggtcggaaca
ttcgaaatgacggatatggacggcaatcattttgatattgcgattccagccttttcgctg
gacagtccgcatgggcaacacactgtgaactga

DBGET integrated database retrieval system