KEGG   Thiomonas intermedia: Tint_0007Help
Entry
Tint_0007         CDS       T01227                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tin  Thiomonas intermedia
Pathway
tin00010  Glycolysis / Gluconeogenesis
tin00052  Galactose metabolism
tin00500  Starch and sucrose metabolism
tin00520  Amino sugar and nucleotide sugar metabolism
tin00521  Streptomycin biosynthesis
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
tin01200  Carbon metabolism
Module
tin_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tin_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_0007
   00052 Galactose metabolism
    Tint_0007
   00500 Starch and sucrose metabolism
    Tint_0007
   00520 Amino sugar and nucleotide sugar metabolism
    Tint_0007
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tint_0007
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Tint_0007
Enzymes [BR:tin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tint_0007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADG29423
UniProt: D5X2E9
Position
complement(12098..13078)
Genome map
AA seq 326 aa AA seqDB search
MTANLSLPATRLVGDIGGTNARFALHTAQGLSDIRVLPTADYARFADALLAYLAATGATA
VRHVAIGIANPVYGDQIRMTNHHWAFSIAQTRAELGLETFLVLNDFAVLARALPELPAAE
LVQVGGGSAVPGAPLALLGAGTGLGVSGLIPDGQGGWTPLAGEGGHVSFAPFDEREVAIW
RLAHARFGHVSAERLLNGAGMAFLHQALGQIAGQTPPERSAAEITRLALDGSDALCHDTV
TLFCTLLGTVAADLAITLGARGGVYIGGGIVPRLGDFFRHSPFRQRFEDKGRTSPYLRDI
PVWVIHSPWPALLGAAAALDQFLQAH
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgaatctctcccttcctgccacccgcctggtcggcgacatcggcggcaccaat
gcccgattcgccctgcacaccgcgcaagggctcagtgatattcgcgtgctgcccacggcg
gattacgcccgctttgccgatgcgctgctcgcctatctcgccgccacgggcgcgaccgcc
gtgcgccatgtcgccatcggtatcgccaacccggtgtatggcgaccagatccgcatgacc
aaccatcactgggccttttccatcgcccagacccgcgccgagctggggctggagaccttt
ctggtgctcaacgatttcgccgtgctcgcgcgcgccctgcccgagttgcccgcggccgag
ctcgttcaggtgggcggcggcagcgccgtgcccggcgcgccgctggcgctgctgggcgcg
ggcaccggcctgggcgtgtcgggcctgattcccgacggacaagggggctggacgccgctg
gcgggcgagggtgggcatgtgagcttcgccccctttgatgagcgtgaggtggccatctgg
cgtctggcgcatgcgcgcttcggccatgtttcggccgagcgtctgctcaacggcgcgggc
atggcgtttttacaccaggcgctcggacagatcgccgggcagacgccgcccgaacgcagc
gccgccgaaatcacacgcctggccctggacggcagcgacgcgctatgccacgacacggtg
acgctgttctgcaccctgctgggcacggtggcggccgatctggccatcaccctgggtgcg
cgcggcggggtgtatatcggcggcggcattgtgccgcggctgggtgatttctttcggcat
tccccgttccgccagcgcttcgaagacaaagggcgcacctcgccgtatctgcgcgatatt
ccggtctgggtgatccacagcccctggcctgcactgcttggcgcagccgcggcgcttgat
cagtttctgcaggcgcactga

DBGET integrated database retrieval system