KEGG   Thiomonas intermedia: Tint_0677Help
Entry
Tint_0677         CDS       T01227                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tin  Thiomonas intermedia
Pathway
tin00072  Synthesis and degradation of ketone bodies
tin00650  Butanoate metabolism
tin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Tint_0677
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Tint_0677
Enzymes [BR:tin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Tint_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADG30076
UniProt: D5X6E9
Position
complement(735621..736412)
Genome map
AA seq 263 aa AA seqDB search
MTMQLSLKDKTAIITGAASGIGKEIAETYAKAGAKVAIADLNLDAANATAEAINKAGGKA
MGVAMNVTDEAQVNAGCAAVAKAFGPVDILVSNAGIQIVNPIEDFAFADWKKLLAIHLDG
AFLTTKAVLPGMYAKKGGVVIYMGSVHSHEASKLKSAYVTAKHGLLGLARVLAKEGGPKG
VRSHVICPGFVRTPLVEKQIPEQAKELNISEDEVIKNVMLKDTVDGEFTTTADIANLALF
LAAFPTAALTGQSIVASHGWCMN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcaactcagcctcaaggacaaaaccgccatcatcaccggagccgccagcggc
atcggcaaggagattgccgaaacctatgccaaggcgggcgccaaagtcgccattgccgac
ctgaacctcgacgccgccaacgccaccgccgaagccatcaacaaggccggtggcaaagcc
atgggcgtggcgatgaacgtgaccgacgaagcgcaagtgaacgccggctgcgcggcggtg
gccaaggccttcggcccggtggacattctggtgtccaacgccggcattcagatcgtcaac
cccatcgaagactttgccttcgccgattggaaaaagctgctcgccattcacctcgacggc
gcctttctcaccaccaaggcggtgctgccgggcatgtatgccaagaaaggcggcgtggtg
atttacatgggctcggtgcattcgcacgaggccagcaagctcaagagcgcctacgtcacc
gccaagcacggcctgctggggctggcgcgggtgctggccaaggaaggcgggcccaagggc
gtgcgctcgcacgtcatctgcccgggcttcgtgcgcaccccgctggtggaaaagcagatt
cccgagcaggccaaagagttgaacatcagcgaagacgaggtgatcaaaaacgtgatgctg
aaagacacggtggatggcgagttcaccaccaccgccgacatcgccaacctcgcgttgttc
ctggccgccttccccacggccgcgctcaccggccagtccatcgtcgccagccacggctgg
tgcatgaactaa

DBGET integrated database retrieval system