KEGG   Thiomonas intermedia: Tint_2055
Entry
Tint_2055         CDS       T01227                                 

Name
(GenBank) outer membrane porin
Organism
tin  Thiomonas intermedia
SSDB
Motif
Pfam: OprD
Other DBs
NCBI-ProteinID: ADG31408
UniProt: D5X2S5
Position
2189128..2190483
AA seq 451 aa
MLGRVHNTNIPEMTTHPFTFRKPLLALALSAASVLSLPTPSQAASPASFFHVSGFVRLYG
FNKNYGAPTKPDQRSSALGEGLNITTDPFLGGFGLGLSLYNANAIETFPAGDKAQETTLM
GAKSSLTTVGQAFVQYARDGALIRAGRQVINTPWMGARDSRMIPQTFQGVWASIAPMKGL
QLMATRINAFRSRTSDSFTHDNLYYPNGYEGDTLYGTTTVFPKKTVLPEASGTSVVGARY
HSGPIHGEAWFYDYTDFTRSTYLNGGYAFGKAHDAFAPYVDAQFMHQTGGSMFQKYKATL
FGKGGAVDSTLWGLRGGVKFSGNNVSLAYNKLEDHANAFGGGSIVSPYGDHTAMYAAVMT
ANLLAYGPGDATELAYSRSFLDHQLKLKVAALKFHTTYSGNPHAVYFDATYALNGKLKGL
SIRERLAISNGASSSAYRSLVYNRLMLQYRF
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgctcggccgggttcataacaccaacatccctgaaatgacgacccatcccttcaccttt
cgcaagcccttgttggctctggccctcagtgccgcttcggtactcagcctgccaacgccg
tcccaggccgcatcaccagcgagcttctttcatgtttcgggatttgtgcgcctctatggt
ttcaacaagaactacggcgcaccaaccaagccggatcagcgctcctcggcccttggcgaa
ggtctcaacatcaccaccgatccctttctcggaggcttcggacttgggctgagcctctac
aacgccaatgccatcgaaaccttcccggcaggggacaaggcgcaagagaccacgctgatg
ggcgccaagtcctccctgaccacggtcggacaggcctttgttcagtacgcacgcgacggc
gcactgattcgggctgggcgtcaggtcatcaacacaccctggatgggagcgcgggactcc
cggatgatcccccagaccttccagggggtatgggcctcgatcgcgcccatgaagggtttg
cagttgatggccacgcgcatcaacgccttcaggagtcggacatccgatagcttcacgcat
gacaacctctactaccccaatggttacgagggagacacgctgtatgggacaaccaccgtt
ttccctaaaaaaaccgtgctgccggaggccagcggcaccagcgtggtgggcgcacgctat
cactccggccccattcatggtgaagcctggttctatgattacaccgactttacgcgcagc
acctatctgaatggcggctacgctttcggcaaagcccacgacgctttcgccccctacgtc
gatgcgcagttcatgcaccagacgggcggctcgatgtttcagaagtacaaggcaacgctg
tttggcaaaggcggagcggtcgattccacgctctggggcttgcgcggcggcgtcaagttc
tcgggcaacaatgtctccttggcctacaacaagctggaagatcacgccaacgcctttggc
ggcggctccatcgtttcgccctacggcgatcacaccgcgatgtacgcggcagtgatgacc
gccaacctgctggcctatgggccgggagatgccaccgagctggcctacagccgaagtttc
ctcgaccatcagctcaagctgaaagtggccgcgctgaagttccacacgacctacagcggc
aatccgcatgccgtttatttcgatgccacctacgctttgaacggcaagctcaagggactg
tccattcgcgagcgcctggcgatcagcaatggggcgtcttcttcggcctatcgctcgctg
gtctacaaccgcctgatgctgcaataccgattctga

DBGET integrated database retrieval system