KEGG   Thiomonas intermedia: Tint_2180Help
Entry
Tint_2180         CDS       T01227                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tin  Thiomonas intermedia
Pathway
tin00220  Arginine biosynthesis
tin00330  Arginine and proline metabolism
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01130  Biosynthesis of antibiotics
tin01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Tint_2180
   00330 Arginine and proline metabolism
    Tint_2180
Enzymes [BR:tin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Tint_2180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADG31531
UniProt: D5X3H3
Position
2328529..2329449
Genome map
AA seq 306 aa AA seqDB search
MSASPVIHLIGAPTDIGAGDRGASMGPEALRVAGIDRALRAQGLTVLDTGNLIGPHNPWQ
PPACGYRHLPEVIAWNTAVHQAVGDVLRAQALPILLGGDHCLAIGSLSAVAQHCRAQGRK
LRVLWLDAHADFNTHTVTPTGNIHGMPVACLCGNGPQALTTLGGPAPQLQPSCIRQIGIR
SVDAEEKRLVHQAGLDVFDMRYIDEYGMRDAMRRALEGVDADTHLHVSFDVDFLDPDIAP
GVGTTVPGGPTYREAQLCMEMIADTGLLASLDVVELNPAFDERNRTAEVAVDLIESLFGK
STLMRK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccagccccgtcattcatctcatcggcgcgcccaccgacatcggcgcgggcgat
cgcggcgcctccatggggccggaagcgctgcgcgtggccggcatcgaccgcgccctgcgc
gctcagggcctgacggtgctcgataccggcaatctcatcggcccgcacaacccttggcaa
ccaccggcctgcggctatcgccatctgcccgaagtcatcgcctggaacaccgcggtacat
caggccgtgggcgatgtcttgcgggctcaagccctgcccatcctgctgggcggcgatcat
tgcctggccatcggctcgctcagcgcggtggcgcagcattgccgcgcacagggtcgcaag
ctgcgcgtgctgtggctcgacgcccatgccgacttcaacacccacaccgtcacgcccacc
ggcaacatccacggcatgccggtggcctgcctgtgcggcaacggcccgcaagcgctcacc
accctgggcggcccggcgccgcaactgcaaccctcctgcatccggcagatcggcatccgc
agcgtggatgcagaggaaaaacggctggtgcatcaggccgggctcgacgtgttcgacatg
cgttacatcgacgaatacggcatgcgcgacgccatgcgccgggcactcgaaggcgtggac
gccgacactcatctgcatgtgagtttcgatgtcgatttcctcgaccccgacatcgccccc
ggcgtgggcaccaccgtgcccggcggccccacctaccgcgaggcgcagctttgcatggaa
atgatcgccgacaccggcctgctggcctcgctcgacgtggtggaactcaaccccgccttc
gacgaacgcaaccgtaccgccgaggtggcggtcgatctcatcgagagcctgttcggcaag
tccacgctgatgcgcaagtaa

DBGET integrated database retrieval system