KEGG   Thiomonas intermedia: Tint_2306Help
Entry
Tint_2306         CDS       T01227                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tin  Thiomonas intermedia
Pathway
tin00010  Glycolysis / Gluconeogenesis
tin00020  Citrate cycle (TCA cycle)
tin00620  Pyruvate metabolism
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
tin01200  Carbon metabolism
Module
tin_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tint_2306
   00020 Citrate cycle (TCA cycle)
    Tint_2306
   00620 Pyruvate metabolism
    Tint_2306
Enzymes [BR:tin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tint_2306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT HlyD_D23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADG31655
UniProt: D5X468
Position
complement(2464713..2466098)
Genome map
AA seq 461 aa AA seqDB search
MAVVEVKVPDIGDFKDVEVIEVLVKAGDQIAVDQSLVTVESDKASMEIPSSAAGVVKALR
VKLGDKVNEGSVLLELDAAGAADAPPAAEAPSAPAVPAAAEPAQPEASPPVALPPAAVGV
GFASEPRHHTPPTAALPVHEPAATTALLPHASPSVRKLARELGVPLAEVKGSGSKGRITA
EDVQAFVKAVMSGQTVTQAAAVAGVGAGKGAASLGGLTLLPWPKVDFAKFGPVSSQPLSR
IKKLSGPNLARNWAMIPHVTQFDEADITELEDFRKSSNERMAKQGVKLTMLAFVMKACVT
VLKQMPAFNSSLDESGENLILKDYIHLGFAADTPQGLVVPVLKDVDKKGLAQIAKEMGEL
AATAREGKLKPSDMQGATFTISSLGGVGGTAFTPIINAPEVAILGLSKSQIKPVWDGAAF
QPRLMLPLSLSYDHRVIDGAMAARFTTVLGELLADLRRVLI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgtcgaggtcaaggttcccgatatcggggacttcaaggatgtggaagtgatc
gaggttctggtcaaggccggagaccagatcgcggtcgatcaatcgctggtcacggtagag
agtgacaaggccagcatggagatccccagcagcgccgccggcgtggtgaaggcgctgcgg
gtgaagctgggcgacaaggtgaacgaaggctcggtcttgctcgaactcgacgccgcaggc
gccgccgacgcaccgcccgccgcagaagctccgtccgctccggccgttccggcagcagcc
gagcctgcgcagcccgaggcatcgccgccggtcgcgctgcctcccgcggcggttggcgtg
ggtttcgcctccgagccgcgtcaccacaccccgcctaccgccgcgttgccggtgcacgag
cctgcagcaaccactgcgctgttgccgcacgcttcgccgagtgtgcgcaagctggcgcgc
gaactcggcgtgccgctggcggaagtcaagggcagcggcagcaagggccgcatcaccgcg
gaggatgtgcaagccttcgtcaaggcggtgatgtcaggccagaccgtgactcaggccgcg
gctgtggcgggagtcggtgcgggcaagggcgcggccagcctgggcgggctcacgcttctg
ccttggcccaaggtggactttgccaagttcggcccggtcagcagccagccgctgtcgcgc
atcaaaaagctctcgggccccaatctggcgcgcaactgggcgatgattccgcatgtcacc
cagttcgacgaggccgacatcaccgagctggaagacttccgcaagagcagcaacgaacgc
atggccaagcaaggcgtgaagctcaccatgctcgcctttgtgatgaaagcctgcgtgacg
gtgctcaagcaaatgcccgcattcaacagttcgctcgatgaaagcggcgagaacctcatt
ctgaaagactacatccacctgggtttcgcggccgatacgccgcaaggtctggtcgtgccg
gtgctcaaggatgtggacaagaagggcctggcgcaaatcgccaaggaaatgggcgagctg
gccgcgacggcgcgcgaaggcaagctcaagccttcagacatgcagggcgcgaccttcacc
atttccagcctgggcggtgtgggcggaacggccttcacgcccatcatcaatgcgccggaa
gtggcgatattggggctgtccaaatcgcagatcaaaccggtctgggacggcgccgcattc
cagccacggctgatgttgccgctgtcgctgtcgtacgaccatcgcgtcatcgacggagcg
atggccgcacgcttcaccaccgtgctcggcgagttgctcgccgacctgcggcgtgtgctg
atctga

DBGET integrated database retrieval system