KEGG   Thiomonas intermedia: Tint_2420Help
Entry
Tint_2420         CDS       T01227                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
tin  Thiomonas intermedia
Pathway
tin01040  Biosynthesis of unsaturated fatty acids
tin01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tint_2420
Enzymes [BR:tin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Tint_2420
Lipid biosynthesis proteins [BR:tin01004]
 Desaturase
  First
   Tint_2420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: ADG31769
UniProt: D5X4V5
Position
complement(2581714..2582919)
Genome map
AA seq 401 aa AA seqDB search
MFDVFLNWAGHGLLRASWWQIVLFALITTHITIASVTIFLHRAQAHRALELHPIASHFFR
FWLWFTTGMVTKEWVAIHRKHHAKCETVDDPHSPVTRGIDTVLLRGAELYRTESRNAETL
SKFGHGTPDDWLERNVYSRFIWQGVGLLLILDVLMFGAIGATVWAVQMLWIPIWAAGVIN
GLGHWWGYRNFSARDSSHNISPWGLLIGGEELHNNHHTYPTSAKLSVKWWEFDIGWAYIR
ALSWVGLAKPRKLPPQFRLGEVRAEVDQLTLQAVIANRYELMARYAAGLKSTLKAELARA
AEQGAVSHLPTLRAAKRWIGIEREILCERSRALVDAAASASPNLSKLLHMREELKSVWEQ
TNLNAEQLRLKLQDWCRRAEDSGLAPLRELSLRLRRYTPTA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgtgtttttgaattgggctgggcacggccttttgcgtgcatcgtggtggcaa
atcgtcttatttgcgctcattaccacgcatatcaccattgcgtccgtcactatttttctg
caccgcgctcaggctcaccgagcgctggaactgcacccgatcgcctcgcactttttccgc
ttctggctgtggttcaccacgggcatggtcaccaaggaatgggtggcgattcatcgcaag
catcacgccaagtgcgagacggtcgacgaccctcacagtccggtgacgcgcggcatcgat
acggtgctgttgcgcggcgccgagttgtaccgaaccgaatcgagaaacgccgaaaccttg
agcaaattcggtcacggcactcctgacgactggttggagcgcaacgtttattcccgattt
atctggcagggcgtcgggcttttgctcattctcgatgtgctgatgttcggcgcgatcggc
gccacggtgtgggccgtgcagatgttgtggattccgatctgggcggctggggtgatcaac
gggctgggtcattggtggggctatcgcaatttttcggcgcgagacagcagccacaatatt
tcgccctgggggttgctgatcggcggcgaagagttgcacaacaaccaccacacctatccc
acgtcggccaagctctcggtcaaatggtgggagttcgatatcggctgggcctatatccgc
gctttgtcctgggtgggtttggccaaaccacgcaaactgccgccgcagttccggctgggc
gaggtgcgcgccgaggtcgatcaactcactttacaagctgtcatcgccaaccgttatgaa
ttgatggcgcgctatgccgcggggttgaagtccaccctcaaggccgagctggcccgggct
gctgaacagggcgcggtgagccatctgccgactttgcgcgcagccaaacgctggatcggc
atcgagcgcgagattctgtgcgagcgttcgcgcgccttggtggacgcggcggcaagtgcc
agccctaacctgagcaagctgcttcacatgcgcgaagagctcaaatcggtgtgggagcag
accaatctgaacgccgaacagcttcgcctgaagctgcaggactggtgccgccgcgccgaa
gacagtggcctggccccgcttcgggagttgtcgctgaggctgcgacgttatacgccgaca
gcctga

DBGET integrated database retrieval system