KEGG   Thiomonas intermedia: Tint_2706Help
Entry
Tint_2706         CDS       T01227                                 

Definition
(GenBank) phosphoesterase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
tin  Thiomonas intermedia
Pathway
tin00562  Inositol phosphate metabolism
tin00564  Glycerophospholipid metabolism
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:tin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tint_2706
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tint_2706
   00565 Ether lipid metabolism
    Tint_2706
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Tint_2706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:tin02042]
    Tint_2706
Enzymes [BR:tin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     Tint_2706
Bacterial toxins [BR:tin02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   Tint_2706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: ADG32047
UniProt: D5X6Q0
Position
complement(2877972..2879720)
Genome map
AA seq 582 aa AA seqDB search
MLRKTLLASAVAVATVTLAACGGGSNSVAASPTVPGTSYTAARALATATPIKHVVVLYQE
NVSFDHYYATYPTATNPAGEPAFTAKAGTPAVNNLVSANLLSNNPNFNNTANGTDAAEPY
RLDRTQAATADQNHAYTAEQQAYDGGKADLFPKYTGAATTGGVGAFGTKGQVMGYYDGNT
VTALWNYAQNFALSDDAYTDTYGPSTPGALEAVSGQTNGVQLVATTDQPFTLSKYSYYIS
DGQGGYGLINDVDPAYDICSSPTNQVSMSGKNIGDLLNGKNISWGGFMGGFNLGATNPNG
TTGCKRSTFSPVVNSTVGDYIQHHNWFQYYKSTANPTHARPSSTLAIGHTLETDNKTADP
ANHEYGLQDFFAAVKAGNMPAVAYLKAPAFEDGHAGYSDPLDEQAFVSQVVNFLEQQPQW
SSTAVIVTWDDSDGWYDHAFANTTNPSFDSQADQLNGAGVCGKGTPLSGVNGKPVNGRCG
PGTRIPFLVISPWAKTNYVSNTPISQASIVRFIEDNWLGGQRLGGGSFDATAGSINNLFD
FTKSVGSAPKVFIDPAQGTVLSAPPAGSLTPQFNVSLFTKQS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcaaaaccctcttggcctcggcggttgccgtggctaccgtcacgctggccgcc
tgcggcggcggttccaattctgtcgcggcctcgcccaccgtgcccggcaccagctacacc
gcggcccgcgcgctcgcgacggccacgccgatcaagcatgtggtcgtgctgtatcaggaa
aacgtgtcgttcgaccactactacgccacctatcccacggccaccaacccggcgggcgaa
ccggcgttcaccgccaaggcgggcacgcctgcggtcaacaatctggtcagcgccaatctg
ctgagcaacaaccccaacttcaacaacaccgccaacggcaccgatgccgccgagccctac
cgtctcgaccgcacccaggctgccaccgccgaccaaaaccacgcctacaccgccgagcaa
caggcttatgacggcggcaaggccgacctattcccgaaatacaccggcgcggcgacgacg
ggcggcgtgggcgccttcggtaccaagggccaggtcatgggctactacgacggcaacacc
gtcaccgcgctgtggaactacgcgcagaacttcgccctgagcgatgacgcttataccgac
acctacggaccgtccaccccgggcgcgctcgaagcggtgagcggccagaccaatggcgtg
cagctggtggcgaccacggaccagcctttcaccctgagcaagtattcgtactacatcagt
gacgggcagggcggctacggcttgatcaacgatgtcgatccggcctatgacatctgttcc
agcccaacgaatcaagtctcgatgtcgggcaagaacatcggcgatctgctcaacggtaag
aacatttcctggggcggtttcatgggcgggttcaaccttggcgcgaccaaccccaacggc
acgacgggctgcaagcgcagcaccttctcaccagtcgtcaactccaccgtgggcgactac
atccagcaccacaactggtttcagtactacaagagcacggccaaccccacacacgcccgc
ccaagctcgaccctggccatcggtcacaccctggagaccgacaacaagactgccgatccg
gccaaccacgaatacggcctgcaggacttctttgccgcagtgaaggccggcaatatgccc
gctgtcgcctatttgaaggcgcctgccttcgaggatggtcacgccggctattccgacccg
ctggacgagcaggccttcgtgtcgcaggtcgtcaacttcctggagcagcagccgcagtgg
agcagcaccgcagtgatcgtcacctgggacgattccgatgggtggtatgaccacgctttt
gccaacaccaccaatccctcgttcgacagccaggccgaccagctcaatggggcgggcgtg
tgcggcaagggtacgccgctcagtggcgtgaacggcaagccggtcaatgggcgctgcggt
ccgggcacgcgcattcctttcctggtgatctcgccctgggccaagaccaactatgtgagc
aacacgcccatcagccaggcgtccatcgtgcggttcatcgaggacaactggctcggcggc
cagcgcctgggcggcgggtcgttcgacgccacggcgggctcgatcaataacctgttcgac
ttcaccaagtcggtgggcagcgcgcccaaggtgttcatcgatccggcgcagggcacggtg
ctgagcgccccgcctgcgggcagcttgacgccgcagttcaacgtctcgctgttcaccaag
caaagctga

DBGET integrated database retrieval system