KEGG   Thiomonas intermedia: Tint_2730Help
Entry
Tint_2730         CDS       T01227                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tin  Thiomonas intermedia
Pathway
tin00071  Fatty acid degradation
tin00072  Synthesis and degradation of ketone bodies
tin00280  Valine, leucine and isoleucine degradation
tin00310  Lysine degradation
tin00362  Benzoate degradation
tin00380  Tryptophan metabolism
tin00620  Pyruvate metabolism
tin00630  Glyoxylate and dicarboxylate metabolism
tin00640  Propanoate metabolism
tin00650  Butanoate metabolism
tin00900  Terpenoid backbone biosynthesis
tin01100  Metabolic pathways
tin01110  Biosynthesis of secondary metabolites
tin01120  Microbial metabolism in diverse environments
tin01130  Biosynthesis of antibiotics
tin01200  Carbon metabolism
tin01212  Fatty acid metabolism
tin02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tint_2730
   00630 Glyoxylate and dicarboxylate metabolism
    Tint_2730
   00640 Propanoate metabolism
    Tint_2730
   00650 Butanoate metabolism
    Tint_2730
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tint_2730
   00072 Synthesis and degradation of ketone bodies
    Tint_2730
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tint_2730
   00310 Lysine degradation
    Tint_2730
   00380 Tryptophan metabolism
    Tint_2730
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tint_2730
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tint_2730
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tint_2730
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tin04147]
    Tint_2730
Enzymes [BR:tin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tint_2730
Exosome [BR:tin04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tint_2730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: ADG32071
UniProt: D5X6S4
Position
complement(2901177..2902355)
Genome map
AA seq 392 aa AA seqDB search
MTDPIVMVSAARTPIGGLLGDFAAVPAWELGATAIAAAVQRAGIAGDAVNEVLMGNCLMA
GQGQAPARQAALKAGLPQSAGAVTLSKMCGSGMRAMMFAHDMLAVGSADVMVAGGMESMT
NAPHLAFVRKGVKYGLTQFYDHMALDGLEDAYDRGKAMGVFAESCVSKYAFSREEMDAFA
IASTERSRQANEDGSFEWEMAPVTVAGRGGEVKIARDEQPFKAKLDKIPTLKPAFKKDGA
ITAATSSSISDGAAALVLMRQSTADKLGCAPIARIRAHAVHAQAPEWFTTAPVGAIQKVL
DKAGWKAADVDLWEVNEAFAAVTMAAMREYKLPHEIVNVHGGAVALGHPIGASGARIVVT
LLGALRQRGLKKGVAALCIGGGEATAMAVELL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcccatcgtgatggtttctgccgcgcgcacgcccatcggcggcctgctcggc
gactttgctgccgtacccgcctgggaactcggcgccaccgccatcgctgctgccgtgcag
cgcgcgggcatcgcgggcgacgccgtgaatgaagtgctcatgggcaactgcctgatggcc
gggcagggccaggcccccgcgcgccaggccgcactcaaggccgggctgccgcaatcggcg
ggcgcggtcacgctgtccaaaatgtgcggctcgggcatgcgggcgatgatgttcgcccac
gacatgctcgctgtgggctcggccgatgtgatggtggccggcggcatggaaagcatgacc
aatgcgccgcatctggcctttgtgcgcaagggcgtgaaatacggcctcacccagttttac
gatcacatggcgcttgacggtctggaagacgcctacgaccgcggcaaggccatgggcgtg
ttcgctgaaagctgcgtgagcaaatacgccttcagccgcgaggagatggacgctttcgcc
attgcctcgactgagcgcagcagacaagctaacgaagacggcagcttcgagtgggagatg
gcgcccgtcacggtggcgggtcgtggcggcgaggtgaaaatcgcccgcgacgagcagccg
ttcaaggccaagctcgacaagattcctacgctcaagcccgcgttcaagaaagacggggcc
atcaccgccgccacctcgtcgagtatttccgacggcgctgccgcgctggtgctgatgcgc
cagtccaccgccgacaagctgggctgcgcgccgatcgctcgcattcgcgcccatgcggtg
catgcgcaggcgcccgagtggttcaccacggcgcccgtgggggccattcaaaaggtgctc
gacaaagccggctggaaggcggccgatgtggacctatgggaagtcaacgaagccttcgcc
gccgtcaccatggcggcgatgcgcgaatacaagctgccgcatgagatcgtgaacgtgcac
ggcggcgcggtggcactgggccaccccatcggcgcgtcgggcgcgcgcatcgtcgtcacc
ctgctgggcgcgctgcggcaacgcgggctcaaaaagggcgtggccgcgctgtgcatcggc
ggcggcgaggccacggcaatggcggttgaactgctctga

DBGET integrated database retrieval system