KEGG   Thermoanaerobacter italicus: Thit_0299Help
Entry
Thit_0299         CDS       T01178                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00010  Glycolysis / Gluconeogenesis
tit00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thit_0299
   00500 Starch and sucrose metabolism
    Thit_0299
Enzymes [BR:tit01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Thit_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ADD01617
UniProt: D3T6K4
Position
340605..342014
Genome map
AA seq 469 aa AA seqDB search
MVHQNMKPFPKDFLWGASTSAYQVEGAWNEDGKGPSVIDMKKHPEGTSDFKVASDHYHRY
KEDIALFAEMGLKAYRFSIAWTRIYPNGTGEINQKGIDFYNNLINELLSYNIEPIVTMYH
FDLPYALQQKGGWSNRETIDAFENYARTLFKYFGDRVKYWLTINEQNMMILHGSAIGTLD
PNMKNPQKELYQQNHHMFLAQAKAINLCHEMCPNAKIGPAPNIAYVYPASSKPEDILAAQ
NFSSIRNWLYLDMPVFGRYNSVAWSYMEEKGCTPTIQEGDMEILESAKPDFIAFNYYATS
TVAESKNNTSDKNPIGDQQITIGEPGFYRGVANPYLEKTQFGWEIDPIGFRITLCELNDR
YNLPLLVTENGLGAYDKLEEGDVVNDDYRIEFLRKHIEQARLAISDGVNLIGYCPWSAID
LVSTHQGFSKRYGFIYVNRDEFDLKDLRRIKKKSFYWYKNVIATNGERL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatcaaaacatgaaaccatttccaaaagactttttatggggagcttccacttcg
gcatatcaggtagagggagcatggaatgaagacggaaaaggtccttcagttattgatatg
aaaaaacatccagaagggacatcggatttcaaagtggctagtgatcattaccatcgttac
aaagaagatattgcattattcgcagaaatgggattaaaggcctatcgattttctattgca
tggacgcgcatttatcccaatggaacaggggagatcaatcaaaaaggtattgatttttat
aataatcttataaatgaattgctgtcctataatatcgaacctattgttaccatgtatcat
tttgatttaccttatgctttgcaacaaaagggaggatggtcgaatagagaaactatcgat
gcatttgaaaattatgctagaacattatttaaatactttggagatcgggtaaagtactgg
ttaactattaatgaacagaatatgatgattttgcacggttcagccattggcactctagat
cctaatatgaaaaatcctcaaaaagagttataccagcaaaatcatcatatgtttttggct
caagcaaaagcaataaatttatgtcacgaaatgtgtccaaatgcgaaaattgggccagcg
ccgaatattgcttatgtttatccagcctcttccaaaccagaagatatcttagcagcacaa
aatttttcatcaatccgaaattggttatatttagacatgccagtatttgggcgttataat
agcgttgcatggagctatatggaggaaaaaggatgtacaccaactattcaagaaggtgat
atggaaatcttagaatctgcaaaaccagattttattgcctttaattattatgcaacatcg
acagtggcagaaagtaaaaataatacttctgataaaaatcctatcggagatcaacaaatt
actattggagaacccggtttttaccgtggagttgcaaatccatatttggaaaagacacaa
tttggctgggaaatcgatccgataggtttccgcattacattatgcgaattaaatgacaga
tataatttgccattattagtaactgaaaatggtttaggagcttatgacaagttagaagaa
ggtgatgttgttaacgatgattatcgtattgaattcttacgtaagcatatagaacaagca
cggttggctatttctgatggagtgaatttaataggatattgtccttggtcagctattgac
cttgtcagtacacatcaaggatttagcaagcgttatggttttatatatgtcaacagagat
gaatttgatttaaaagacttaagaagaataaagaagaagagcttttattggtataaaaat
gttatagctacaaatggggagaggttatag

DBGET integrated database retrieval system