KEGG   Thermoanaerobacter italicus: Thit_1131Help
Entry
Thit_1131         CDS       T01178                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00620  Pyruvate metabolism
tit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Thit_1131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tit02000]
    Thit_1131
Enzymes [BR:tit01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Thit_1131
Transporters [BR:tit02000]
 Other transporters
  Primary active transporters [TC:3]
   Thit_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: ADD02398
UniProt: D3T8W6
Position
1167324..1168721
Genome map
AA seq 465 aa AA seqDB search
MSNKIKITETVLRDAHQSLLATRMSTEEMLPIAEKLDAVGYYSIEAWGGATFDACMRFLN
EDPWERLRKLKKKIKNTPLQMLLRGQNLVGYRHYPDDIVEKFVEKAVTNGIDIIRIFDAL
NDVRNLEVAIKATKKAGAHAQGTLVYTISPVHNIDHYIKVAKELVELGVDSICIKDMSGI
LTPYIAYELVKSLKETVNVPIQLHTHYTSGMAAMTYLKAIEAGVDIIDTAISPLALGTSQ
PATETIVAVLKGTPYDTGLDMDLLSEIASYFKKVKQNYSKEIDLSMVMGVDTDVLIYQVP
GGMLSNLISQLKQQNALDKYPEVLKEIPKVREELGYPPLVTPMSQMVGTQAVLNVITGER
YKMVPKEVKDYVKGLYGRPPAPISEEIKKKIIGDEVVIDVRPADLLKPQFETIKEEIKEY
YEQEEDVLSYALFPQVAKKFFEYRRAKKYQIDETLLNKEYMTYPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaaattaaaattacagaaactgtattaagagatgctcatcagtcactattg
gctactcgaatgtcgacggaagaaatgcttccaattgcagagaaattggatgcagtagga
tattattctattgaggcatggggaggagctacttttgatgcttgtatgagattcctcaat
gaggacccatgggaaagattaagaaaattaaaaaagaagataaaaaatacacctcttcaa
atgcttttgagaggacaaaatctagtaggatataggcattatccggatgatattgtagaa
aaatttgttgagaaggctgtcacaaatggaatagatataataagaatttttgatgcccta
aatgatgtacgaaatcttgaagttgcaataaaagctactaaaaaagcaggagctcacgct
caaggtacccttgtttatactataagtcctgttcacaacattgaccattatattaaagta
gcaaaagagctagtggaattgggggtagattctatatgtataaaggatatgtcaggaata
ttgactccttatattgcgtatgagctagtaaaaagccttaaagaaacagtaaatgttcct
atacagttacatacccattataccagtggaatggcagctatgacttatcttaaagcaata
gaggcaggagtagatataatagacactgctatttcacctttggcattaggaacttctcaa
cctgccacagaaacaatagtagctgttttgaaaggaactccatatgatactggcttggat
atggatttattatcggaaattgcttcatactttaaaaaagtaaaacaaaattacagtaag
gaaatagatttatctatggttatgggcgtagatacggatgtattaatttatcaagttcca
ggaggaatgttatcaaatttaatttctcaattgaagcaacagaatgctttagataagtat
ccagaagttttaaaagaaattcctaaagtcagagaagaattaggatatccacctcttgtt
acacctatgagtcagatggtagggactcaagctgtcttgaatgtcataactggagagagg
tataaaatggtaccaaaagaagtaaaagattatgtgaaaggattatatggtagaccaccg
gctcctatttcagaagaaataaaaaagaaaataataggagatgaagtggtaatagatgta
agacctgcagaccttttaaaaccgcaatttgaaacgattaaagaagaaattaaagaatat
tatgaacaagaagaagatgttttatcttatgctcttttcccccaagtagctaaaaaattt
tttgaatatagaagggcaaaaaaataccaaatagatgaaactcttctcaataaagaatat
atgacatatccagtctga

DBGET integrated database retrieval system