KEGG   Thermoanaerobacter italicus: Thit_1844Help
Entry
Thit_1844         CDS       T01178                                 

Definition
(GenBank) multi-sensor signal transduction histidine kinase
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c PAS PAS_9 GAF HisKA PAS_3 PAS_4 GAF_2 PAS_8 HATPase_c_3 GAF_3 Staphostatin_B
Motif
Other DBs
NCBI-ProteinID: ADD03086
UniProt: D3T4D4
Position
1890170..1892461
Genome map
AA seq 763 aa AA seqDB search
MNTFRTLVCIESAEKYRNFLTIIEQNYENTLVLSDVSELQKELMSNEKTINVIFIDNMLL
DKITDSLSSILELENNFCIVLFEEYVSTYERRSFIYDVLECNDIYKISNFLIRLERKLNR
KAQLLSFQDEIKRFYDIGKKLSSEKDLMTLLELIIETCMDMTSSDAVTIYAIIDSDSGEW
SYYDKNAKNKMLKFIIAKNNSIKLNLESMTFPISKNSIVGYAVISGEPLRIDNAYCIPEG
ADYQFDRKFDNLTGYTTKSILTIPMKDHQDRVLGVIQLINKKQGDIIIPFSLNDEMIIHS
LAGQAAVAIENSILYKNMETLLEQYRQTIYEEITKRRLADEEIHKLLSAVEHSPVSVVIT
DINGTIQYVNPKFTEVTGYTYKEVIGKSLNILKSGKHTKEFYYNFWNTILSGKEWSGEFY
NKKKNGEFYWDSTLVSPLKDESGSIKYFIAVKEDVTEKKLLAQKLEEKNRELQETIKKLN
ETQTQLIQQEKMAGIGQLAAGVAHEINNPLGFIMSNFEVLQKYANILKETLLYYKDFISA
YQSLNFEEAKLKIEHIKNFEKKNKMDFILEDLSELFHDTNIGLERVKNIVNALRSFSHID
QLNNFEEYDLNEGIRTTLLIAKSNLKHDINIREDLGNIPLIPAIGGEINQAILNIIMNAA
QAIRMKGIDSEGIIEIRTYNDENYVYLEVKDNGIGIEEKNLNRIFEPFYTTKPIGEGTGL
GLSITYDIIVKKHNGEILVESKYGEGAKFVIKLPIKRIEKDSI
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacctttagaacgctagtttgcatcgaatctgccgaaaaatatagaaattttctc
actataatcgaacaaaactatgaaaacacactggtattgtcagatgtatcagagctgcaa
aaagaactgatgtctaacgaaaagactattaatgtcatttttatagacaatatgctgttg
gacaaaataaccgacagtttatcctctatacttgaactcgagaacaacttctgcatagta
ctgtttgaagaatatgtaagtacctatgagagaaggtcttttatatacgacgtattggaa
tgtaacgatatatacaaaataagtaattttctgataagattggaacgtaaattgaaccgc
aaggctcaactcctctcttttcaagatgaaataaagaggttttatgatattggaaaaaaa
ctatcatctgaaaaagacctcatgacattgctggaattaatcattgagacctgcatggac
atgacctcatcagatgccgtgaccatatatgccattatagacagcgatagcggtgagtgg
tcctattatgataaaaacgctaaaaacaaaatgctaaaattcataatagctaagaacaac
agcataaaactaaatttggaatcaatgacatttccgatttcaaaaaacagcattgttggc
tacgccgtaatatccggagagccccttcgaattgataacgcttactgcataccagaaggc
gctgattatcaatttgacagaaaatttgataatctcacgggctatacgactaaatcaatt
cttacaatacctatgaaggaccaccaagacagggtattgggagtaattcagttgatcaat
aaaaagcagggcgatatcattatcccatttagcctcaatgatgaaatgattattcactca
ttggcgggccaagctgcagtagccatagaaaacagcatactctacaaaaatatggaaacc
cttttggaacaatacagacaaacgatttacgaagaaattaccaaacgaaggctggcagac
gaagaaatacacaaactgttgagcgccgttgaacacagccctgtctcggtcgtaattacg
gacataaatggaaccattcaatatgtaaatcccaaatttactgaagtgacaggctatact
tacaaggaagtcataggtaaaagtcttaacattttaaaatcaggaaaacacacaaaagag
ttctattataacttttggaatacaatactgtcgggtaaagaatggagtggagaattctac
aataagaaaaaaaatggagagttctactgggattcgactcttgtgtcaccattaaaagat
gaaagcggctctataaagtattttattgctgtcaaggaagatgtcaccgaaaagaagtta
ctcgcccaaaaacttgaagaaaaaaatagagagttgcaggaaacaataaaaaagttaaac
gaaactcagacacaattgatacaacaggagaagatggccggaatcggccaattggctgca
ggagttgctcatgagatcaataacccactgggattcattatgagtaattttgaagtatta
caaaaatatgcaaacatactaaaagaaactttactatattataaagacttcatatctgcc
tatcaaagcttaaactttgaagaagcgaaactgaaaatcgaacatattaaaaattttgag
aaaaaaaacaaaatggacttcatattagaagacttgtccgaattattccatgatacaaac
atcgggcttgaacgggtgaaaaatatagtaaatgctttaaggtccttctcccatattgac
caattgaacaatttcgaggaatatgacctgaatgaaggaatacgaactactttacttata
gcaaaaagtaatctgaaacatgacataaatattcgtgaagaccttggcaatatcccttta
ataccagcaataggaggggaaataaatcaagctatattaaatataattatgaatgccgct
caagctatcagaatgaaaggtattgacagcgaaggaattattgaaataagaacttataat
gatgaaaattatgtatatttagaagtcaaagataacggcataggaatcgaagagaaaaac
ctgaacagaatttttgaacctttttatacaacaaagcctatcggagaagggacaggattg
ggattaagcatcacatatgatataattgtaaaaaaacacaatggcgaaattttagttgag
agcaaatacggtgaaggcgccaaatttgtcattaaacttcctattaaaagaattgaaaaa
gattctatatga

DBGET integrated database retrieval system