KEGG   Thermoanaerobacter italicus: Thit_1852Help
Entry
Thit_1852         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD03094
UniProt: D3T4E2
Position
complement(1899358..1901370)
Genome map
AA seq 670 aa AA seqDB search
MNLKKILIIIIALSLIVSVLVDVNRIKVENKYDTVEIVGDLKSFKDLASVTGRDLTSVLS
DMKSAGLIGVAVNEVTLESLQQSGEISLSLLKDVINLYLLSSNLGNEALEDYLKSLTDKE
REQYGNYIVVTTKDVKIFNFLKEALTKRVPEDGLKVLEKRGSYAFVINKPKDVFITKGLG
FDESDLGLVKSLGFDVIPRIENFTGIRDKDIEEYVDILKKFNVKTVIFNGTDVLGNPEKI
PYAASLFKKNDINVGIIDVPMGKKLQEGMNKFAKFDSYKGIKVFGVSEAETQKYDASEII
NRWYRGMIERNVRIIYMRAKVEHFKSADYNIEQNKSMIEDMTKYIKKVGLKVGVAKPLSE
LHQSKLTEILISLGVIAGGLLLLQMLGIGDYVLILLGLLGTVLTSLVLVSRFNDLGVKVI
ALASSIIFPSLGIGYFIDKMKEILDRKKNLSFTYTSLKIFINSLLISFVGALSIAAIMAD
SKYMLKIDYFRGVKLSFVLPLLFYVLYYIVKIYDANDWKTFMERIKEFLNIDIKVWHLVA
IVIAGIIGIIYISRTGNEPIVKPTELELKFRDFLEHTLVARPRTKEFLIGDPAIILAIYA
AFKNSKGWAFIMGIFASIGILSIVNTFSHIGSVLPIAIERTVIGWVLGALIGMIAVFIVD
KTLKNIKREY
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
ttgaatctaaagaaaatacttataataattattgcgctgtctttaatagtatctgttttg
gtagacgtaaacagaataaaagtggaaaacaagtatgacacagtagaaattgtaggagat
ttaaaaagtttcaaagaccttgcgtctgtaacaggcagagacttaacttctgtgctttct
gatatgaaatcagctggtcttataggtgttgctgtaaatgaggttactctggaaagcctt
caacaatctggtgaaatttctttaagccttttaaaggacgtaataaatctttatttatta
tcttcaaatttagggaatgaagcattggaagactacttaaagagtcttacagataaggaa
agagagcagtatggcaattacatagttgtaacaacaaaagatgtaaagatattcaatttt
cttaaagaggctttaacaaaaagagtacctgaagatggattaaaagtgcttgaaaagaga
ggtagctatgcctttgttatcaataaacccaaagatgtttttataacaaaggggttagga
tttgatgaaagcgatttaggactggtaaagtcgttaggctttgatgtgataccgcgaatt
gaaaatttcacaggtataagagataaagacatagaagaatatgttgatatattaaaaaaa
tttaatgtaaagactgtaatctttaatgggactgatgttttaggaaacccagaaaagata
ccgtatgcagcttccctgtttaagaaaaatgacataaatgtaggcattatagatgtacct
atgggtaagaaacttcaagaggggatgaataaatttgctaagtttgatagttataagggg
ataaaagtctttggagtttcagaagcagaaactcaaaaatacgatgcttctgaaataata
aatagatggtatagaggaatgatagagagaaatgtgagaattatttatatgagagcgaag
gtagaacattttaaaagtgcggattacaatatagaacaaaataaatctatgatagaagac
atgacaaaatacataaaaaaagtgggattaaaagttggtgttgctaaacctctttctgag
cttcatcagtcaaagcttacggaaatactcataagtttgggagttattgccggcggctta
ttgcttttgcagatgttaggaattggagactatgtgctaattttattaggattgttgggg
actgtactgacttctttagtgctggtaagcagatttaacgatttaggggtcaaagtaata
gcattagcttcttctataatttttccttctcttgggataggatattttatagacaaaatg
aaagaaatattggacaggaagaaaaatctcagtttcacatatacctctttaaaaatattt
attaattcgctattgatttcttttgtaggggctcttagtatagcggctataatggctgat
agcaaatatatgttgaaaattgactattttaggggtgtaaaactttcttttgtactacct
ttactgttttatgttttatactatattgtaaagatatacgatgccaatgactggaagact
tttatggaaagaataaaggaatttttaaacatagacataaaagtatggcatttggtagct
attgttatagcagggatcattggaattatatacatttcaaggacgggcaatgaacctatt
gttaagccaacagagttagaacttaaatttagagactttcttgagcatactcttgtagca
aggcctcggactaaagagtttttaataggtgaccctgcgattatattagcaatttatgct
gcttttaaaaattccaaaggctgggcatttattatgggaatatttgcttcaataggtatc
ttgtcaattgttaatacttttagccacatcggaagcgtgcttccgattgcgatagagcgt
actgtaattgggtgggtgttgggggctttaattggcatgattgctgtatttatagtggac
aagaccttaaaaaatataaaaagggagtattga

DBGET integrated database retrieval system