KEGG   Thermoanaerobacter italicus: Thit_1853Help
Entry
Thit_1853         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FadA EphA2_TM
Motif
Other DBs
NCBI-ProteinID: ADD03095
UniProt: D3T4E3
Position
complement(1901485..1901937)
Genome map
AA seq 150 aa AA seqDB search
MKKVYALILVFVAILVALSVGYADQNSEPGSQQDPLVSKSYVDSQYNEVKAYVDDKLKEA
KTGASYEVVELNAGEVLTMEGGTQAIVRIANSAVIVTKTDGVADLTAGTNLKNNDIIPAN
HLLLFPRSDGRGIKATKRTYIVVIGKYTKN
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtttatgcacttatactggtttttgttgcaattttagtggctttaagtgtt
ggttatgctgaccaaaattctgaaccaggaagtcagcaagacccccttgtcagtaaaagc
tatgttgattcgcaatataatgaggtaaaagcttatgtggatgataagctaaaagaggca
aagacaggggcaagctatgaggtagttgaattaaatgctggcgaagttttaaccatggaa
ggtggcacacaagcgatagtgagaattgcaaattcagcagtaattgttacaaaaactgat
ggagtggcggaccttactgcaggtacaaatttgaaaaataacgatattatacctgccaat
caccttttgctttttccacgatctgatggtagaggaataaaagcgacaaaacgaacatac
atagtcgtaataggtaaatatacaaaaaattaa

DBGET integrated database retrieval system