KEGG   Thermoanaerobacter italicus: Thit_1858Help
Entry
Thit_1858         CDS       T01178                                 

Definition
(GenBank) carbohydrate kinase, YjeF related protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
K17759  NAD(P)H-hydrate epimerase [EC:5.1.99.6]
Organism
tit  Thermoanaerobacter italicus
Brite
KEGG Orthology (KO) [BR:tit00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Thit_1858
Enzymes [BR:tit01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     Thit_1858
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.6  NAD(P)H-hydrate epimerase
     Thit_1858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase YjeF_N Phos_pyr_kin HK
Motif
Other DBs
NCBI-ProteinID: ADD03100
UniProt: D3T4E8
Position
complement(1904957..1906486)
Genome map
AA seq 509 aa AA seqDB search
MIVLTSKQMREVEKIAIEKIGIPSICLMENAGRETALEVKKILEEKNLNSVIIISGKGNN
GGDGYVVARNLYNWGVDVKVFLTTSIGAISGDAKVNLDAILNMGIYVAEITQREHLKFLE
KAIKESNVIVDAIYGIGLKGRITGIVKDIIEMINQANKIVVSVDIPSGLNADTGKIEGCA
IKASKTVTMQFVKPGLLVYPGVDYAGEVRVAEIGIPYRLAAEIGKIYLVTSEDVKLPKRL
GDTHKGNYGKALIIAGSKNMTGAAYLCAKGAIKTGCGLVKLAVPQSAQSVIQGALYEVIT
YGLEEKNGILSYNALSSVLKLIDESDVIAIGPGLTHDKDISQLVYDIVKNIDKPVVLDAD
ALNALVGRLEVIQGKRIILTPHYGEMSRLTGLGTDEIKNNLFEVAKTFIDRYKVTLVLKG
AKTVIATKEGSIYINSTGNPGMATAGSGDVLTGMITAFLAQGFSEEKAAIHGVFYHGKAG
DIAREYVGEYGMTAMDILENIPDALKCGL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgctgacatcaaaacagatgagagaagttgaaaaaatagctatagaaaaaata
ggaattccttctatatgtctaatggaaaatgcgggaagagaaacagcactagaagtaaaa
aagattttggaagagaaaaatttaaactctgtaataatcatatcagggaaaggaaataat
gggggagatggttatgtagtggctagaaatctttataattggggagtcgatgtaaaagta
tttttaactacaagtataggtgctatttcaggagatgcaaaagtaaatttagatgcaatc
ctaaatatggggatttatgtagcggaaattactcaaagagaacatctaaaatttttggaa
aaagctattaaagagagcaatgtcattgtagatgctatttatggaattgggcttaaagga
agaataacaggtatagtaaaagatattatagaaatgataaaccaagcaaataaaattgtg
gtatctgtcgatattccttctggattaaatgctgatacgggtaaaatagaaggttgcgct
attaaggctagtaaaacagttactatgcagtttgtgaaacctggcttattagtgtatcca
ggtgtcgattatgcaggagaagttcgtgttgctgaaatagggattccttaccggttagca
gcggagatagggaaaatttaccttgtgacttcagaagatgtaaaacttccaaaacggctt
ggagatactcataaaggaaattatggaaaagctttgattatagctggctctaaaaatatg
acaggagcagcatatctttgcgctaaaggtgctattaagacaggttgcggattggtgaaa
ttagcagttccccaaagtgcccaatcagtaattcagggagcactttatgaggtcataacc
tatggattagaggagaaaaatggtattttgtcctataatgctttaagtagtgtacttaag
ctaatagatgaaagtgatgttattgctataggaccaggattgactcatgacaaagatatt
tcacagttggtgtatgacattgtaaaaaatatagataagcctgtagttttagatgctgat
gctcttaatgctttggtaggaagattggaagttatacaaggcaaaagaattattctcact
ccccattatggggaaatgtcgagattgacaggtctcggcacagatgagattaagaataat
ctttttgaagttgcaaaaacttttattgataggtacaaagtgacacttgtacttaaaggt
gctaaaacagtaatagctactaaagaaggtagcatatatataaatagcacgggcaatcct
ggcatggcaactgctggaagtggggacgtcctaacagggatgattacagcttttttggct
caaggatttagtgaggaaaaagcggcaatccatggggtattttatcatgggaaggcggga
gatatcgccagagaatatgtgggagagtatggaatgacagcgatggatatacttgagaac
attccggatgctcttaaatgcggtttgtaa

DBGET integrated database retrieval system