KEGG   Thermoanaerobacter italicus: Thit_1859Help
Entry
Thit_1859         CDS       T01178                                 

Definition
(GenBank) holo-acyl-carrier-protein synthase
  KO
K00997  holo-[acyl-carrier protein] synthase [EC:2.7.8.7]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00770  Pantothenate and CoA biosynthesis
Brite
KEGG Orthology (KO) [BR:tit00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Thit_1859
Enzymes [BR:tit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.7  holo-[acyl-carrier-protein] synthase
     Thit_1859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACPS
Motif
Other DBs
NCBI-ProteinID: ADD03101
UniProt: D3T4E9
Position
complement(1906449..1906865)
Genome map
AA seq 138 aa AA seqDB search
MEIFVGTDIVEVERIKKAFNTYSKFLERIFTQKEIEYFNSKRRNLTHIAGFFSAKESVSK
VLGTGIGSFSWKDIEICHNEKGAPVVILKGKAKSIADKKGIRDIKLSISHTKTHAISCAI
AIGGEKNDSADIKTDERS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatttgttggaacggatattgtagaagttgaaaggataaaaaaagcttttaat
acatattctaaatttttggaacgaatatttactcaaaaggagatagagtattttaacagt
aaaaggaggaacttgacccatatagcgggttttttttccgcgaaagaaagcgtctcaaaa
gtcttaggaacagggataggtagttttagctggaaagatattgaaatatgtcacaatgaa
aagggagcgcctgttgtaattttaaaagggaaagctaaaagtattgcggacaaaaaggga
ataagggatataaagctatctatttctcatacaaaaacccatgctataagctgtgctatt
gctattggaggtgaaaaaaatgatagtgctgacatcaaaacagatgagagaagttga

DBGET integrated database retrieval system