KEGG   Thermoanaerobacter italicus: Thit_1867Help
Entry
Thit_1867         CDS       T01178                                 

Definition
(GenBank) Ku protein
  KO
K10979  DNA end-binding protein Ku
Organism
tit  Thermoanaerobacter italicus
Pathway
tit03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tit00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Thit_1867
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:tit03400]
    Thit_1867
DNA repair and recombination proteins [BR:tit03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Thit_1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ku DUF2767 DUF2256
Motif
Other DBs
NCBI-ProteinID: ADD03109
UniProt: D3T4F7
Position
1912672..1913484
Genome map
AA seq 270 aa AA seqDB search
MRSMWKGAISFGLVSIPIKLYTATEDHAIHFRQLHKECKTPIKYEKICPVCNRPVSDEEI
VRGYEYEPGKFVIIDEEDLERIPMPTVKTIDIVDFTDIGQIDPIYYDKTYFIVPEDIGTK
PYVLLRDSMKETKRVAIAKVVIRSKQSLACIRVYDEKYMVMETMHFPDEIKSTNQLPPLR
EVNLHENEIKMAKQLVDTLTSDFKPEKYDDNYRKTLIEMIESKIQDKEIEIPQKAPEADN
VLDLVSALKASIESVKKEEKAKKGRKRKGA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcaatgtggaaaggagcaataagttttggtcttgtaagtatccccataaaactg
tataccgctacagaagaccatgcaatacattttaggcaacttcataaagaatgtaaaact
cctataaaatatgaaaaaatttgccctgtatgtaatagacccgtttcagatgaggaaata
gtgcgaggatatgaatacgaaccaggtaaatttgtcattatagatgaggaagatttggaa
aggatacctatgccaacagttaaaaccattgatatagtagattttaccgatataggacaa
atagaccccatatattatgataaaacatatttcattgtacccgaagatattggtacaaag
ccttatgtacttttaagagattctatgaaagaaacaaaacgagttgcaatagcgaaagtg
gtaatcaggtccaagcaaagcctcgcatgcatacgagtgtacgatgaaaaatacatggtc
atggaaacaatgcattttcccgatgaaataaaaagcacaaaccaacttcctcctttaaga
gaagtcaacttgcatgaaaatgaaataaaaatggccaaacaacttgttgatactctaacc
tcagatttcaaacccgaaaaatatgatgataactacagaaagacgttaattgaaatgatt
gagtcaaagatacaagacaaagaaatagaaattccccaaaaagcacctgaagctgacaat
gtcctcgatttagtaagtgcactaaaagcgagtattgaatctgtaaaaaaagaagaaaaa
gcaaaaaaaggtcgcaaaagaaaaggcgcataa

DBGET integrated database retrieval system