KEGG   Thermoanaerobacter italicus: Thit_1871Help
Entry
Thit_1871         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prok-JAB JAB
Motif
Other DBs
NCBI-ProteinID: ADD03113
UniProt: D3T4G1
Position
complement(1917043..1917561)
Genome map
AA seq 172 aa AA seqDB search
MHNEALIFQKSDGGRIKIDVYALKKINKFLQTERSNCEAGGVLLGRYIIDSNDIIVDDIT
MPMKNDIRHRSFFLRRKRLHQKVVTKRWLESKGTCNYLGEWHTHAEAIPTPSCVDIKEWK
KLLSTSIFDNDCLYFIIAGTEKIRVWEGNKYTMEIRQLNEMSSWMVNSYEKI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcataatgaagcattgatttttcaaaaaagtgatgggggtaggattaaaattgatgta
tatgccctcaaaaagattaacaaatttttacaaactgagcggagtaattgtgaagcggga
ggcgttttattagggagatatattattgattcaaatgatatcatagtagatgatattact
atgcctatgaaaaatgatataagacatagatctttctttttaaggagaaagagattacat
cagaaggtagtgacaaaaagatggcttgagagcaagggtacatgtaattatttaggggag
tggcatacacatgctgaagcaattcctaccccatcatgtgtagatataaaagagtggaaa
aaattattgagtacttcaatatttgataatgattgcttatattttattatcgctggaaca
gaaaagataagagtatgggaagggaataaatataccatggaaataaggcagttaaatgaa
atgtcgagttggatggtgaatagttatgaaaaaatatag

DBGET integrated database retrieval system