KEGG   Thermoanaerobacter italicus: Thit_1875Help
Entry
Thit_1875         CDS       T01178                                 

Definition
(GenBank) Tn7-like transposition protein C
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TniB AAA_22 MMR_HSR1 AAA AAA_16 RuvA_C AAA_29 GP24_25 Endotoxin_N
Motif
Other DBs
NCBI-ProteinID: ADD03117
UniProt: D3T4G5
Position
complement(1922436..1924097)
Genome map
AA seq 553 aa AA seqDB search
MDKLKIPNGTVAVLAEYKEQVIPEYRGNPFIEVLPPILSAEEAAERLAYYPPYHPQERNL
ESHYRIHMVQRLFQIFQPLPIHLDLESRISRLLRQGYLARNPLKPQFVQYLKKSDEVIKG
INGVLETNELFRTTASGFSIVGVSGMGKSTAVNQILCMYPQVIIHSHYKETKFSVYQLVW
LKLDCPFDGSIKGLCIEFFNKVDSLLGTDYCKKFGNGRYSVDNMVNAICKIAQNLGLGLL
VIDEIQHLNEAKSGGDQRMLNFFVTLVNMLGLPIVLVGTPKALSVLQSQFRQARRGSGQG
DMIWERLKKDDTWQLLIDALWGYQWTRKETPLTAEINDTLYEESQGIIDIAVKLYAMSQI
KAIISGKEEITPDLIRQVAKENLQLVQPMLQALKKGSLREIAKYDDICTVNVDFAGFLDR
SKQTVETEMRLQALQKQRKEEEKEALLSIKEQAIIKLLELNIEAKKAQKAVEQVIEAEGE
KIDVSELVVKAIKLLSTSVEKTNRKTRRTSRKMDENDIRFIVEEGRKKQLTAYEALKEKG
LIKGIDNVIFQVG
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggataaactgaaaataccgaacggtacggtggctgtacttgcggaatataaagagcag
gtaattcccgaataccgagggaatccctttatcgaagttcttcccccgattttaagtgct
gaagaagcggctgaaaggcttgcttattacccgccatatcaccctcaggagcgaaacctt
gaaagccattaccgcatccacatggttcagcggctttttcaaatatttcagccccttcca
attcaccttgatttggagagcaggatctcaaggttgctgcgacagggctaccttgcccgc
aaccctttaaaaccccagtttgtacagtatctgaaaaaatcagatgaggtaataaaggga
attaacggagttctggaaaccaatgaattgtttcgtactactgcttcaggtttcagcatc
gtcggcgtaagcggtatgggcaaaagcacggcggtaaaccagatcctgtgcatgtatccc
caggtgatcatacattcgcactataaagaaaccaaatttagcgtgtatcagcttgtttgg
ctcaagcttgactgcccattcgacggctctataaaaggcctgtgtattgagttttttaac
aaagtggacagcttgttggggacagactactgtaaaaaattcggaaatgggcgctacagc
gtcgacaacatggtgaatgctatctgcaagatcgctcagaacctcggccttggcttgctt
gtaatcgatgaaattcagcacctcaatgaagcaaaaagtggtggagatcagcgtatgcta
aacttctttgttactttggtcaatatgcttggcttacccatagttctggtcggcacgcca
aaagctttgagcgtgctgcagtctcaattcaggcaggcgcggcggggcagcggccagggg
gatatgatttgggaaaggttgaaaaaagacgacacatggcagctccttatagatgcactt
tgggggtatcagtggaccaggaaagaaactccgcttaccgctgaaatcaatgatacactc
tatgaagaaagtcagggaattatagatattgctgtaaagctctatgctatgtcgcaaatt
aaagcaatcatctctggaaaagaagaaatcactcctgatcttataaggcaggtcgcaaaa
gagaatttgcagctggttcagcccatgctgcaggctttgaaaaaaggaagcttaagggaa
attgcaaaatatgacgatatttgcaccgtaaatgttgactttgcaggtttccttgacagg
agcaaacaaaccgtagagacagaaatgcggctgcaagcgctacaaaagcaaagaaaggaa
gaagagaaagaagcgttgctttctattaaagaacaggcgattataaagctgctggagcta
aatattgaagcgaagaaagctcaaaaagcggtcgagcaagttatagaagcagaaggggag
aagattgatgtttcggagctggtggtaaaggcgatcaagcttctttctacttctgtagaa
aagacgaatcgtaaaaccaggcgcacttccaggaagatggatgaaaacgacatacgcttt
attgttgaggaaggcaggaagaagcagttgacggcttatgaggcgttaaaggagaagggg
ctcataaaaggtatagacaatgttatatttcaagtggggtga

DBGET integrated database retrieval system