KEGG   Thermoanaerobacter italicus: Thit_1899Help
Entry
Thit_1899         CDS       T01178                                 

Definition
(GenBank) DNA methylase N-4/N-6 domain protein
  KO
K00571  site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
tit  Thermoanaerobacter italicus
Brite
KEGG Orthology (KO) [BR:tit00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:tit02048]
    Thit_1899
Enzymes [BR:tit01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     Thit_1899
Prokaryotic defense system [BR:tit02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    Thit_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N6_N4_Mtase MethyltransfD12 Cons_hypoth95
Motif
Other DBs
NCBI-ProteinID: ADD03137
UniProt: D3T4I5
Position
complement(1951207..1953096)
Genome map
AA seq 629 aa AA seqDB search
MPQTSLIEELPKIVAEGKKEVERIMERLQSPNRIRLQTNELVIPSKDMRGFLSGQTGVYN
PQDWYNRLIYGDNLLVMQALLAGDEESGLPSLRGKIDLIYIDPPFDSKADYRTKITLPGG
DIEQKPSVIEQFAYSDTWKEGTVSYLKMLYPRLVLMKELLSDRGVICVHVDWHVGHYVKI
LLDEIFGKDKFVNEIVWYYYNKYSNAKKCLPRAHDNILVYSKNNDHIYNEIRIDRGETVK
QLVRVNVNGVLQNARDENGNLLYREVNDKKADDVFIIPQLQPASSEWMNYKTQKHHDLLE
RIIKIFSNEDSIVADFFAGSGTTGAVAERLGRRWIMCDIGKPACMIMRKRLIDQNAKPFL
YQSVGDYQKEVFASSKMFKRVGDLSQVVLGLYGALPFKPEQNPSRNLGYIKNTRTLVYVD
SPSKLTGYNTLKKAQELRETFLGGWDKVIVLGWNFTIDIGKVINELNDSRLEVQVIPADL
LDRLKKTSYEKLVKENKIRFSSLQYLTIKPIQRIELDAETELLNVELDNYILLSPDALPL
DDEYKEKVQEIMAKDPLALIEYWSIDPDYDGEMFVSKWQDYRENTDNDSDPYKVVTKVQL
KVPKKEGKRKVCVKAVDIFGFESVVIEEV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaacttctttaattgaagaacttcccaaaattgttgctgaaggcaaaaaagaa
gttgaaaggataatggaaagacttcaaagtcctaacaggataagattacaaacaaatgag
cttgtaataccctctaaagatatgagaggttttttaagtggacaaacaggggtatataac
cctcaagattggtataacagattaatatatggagataacctgcttgtaatgcaggcactt
cttgctggagatgaagaaagcgggcttccatctttgagaggaaaaatcgatttgatttat
attgacccaccttttgattcgaaagctgattatagaaccaaaattactcttccaggtggc
gatatagagcagaagccatcggttatagagcaatttgcatattcggacacatggaaagaa
ggaactgtaagttatttaaaaatgctttatccaagattggttttaatgaaggagttatta
agtgataggggagttatttgtgtccatgttgattggcatgtgggacattatgtgaagata
ttgttagatgaaatatttgggaaggataagtttgtaaatgaaatagtttggtattactat
aacaagtattctaatgctaaaaaatgtttaccacgtgcacatgataatattcttgtttat
tccaaaaataatgaccatatttataatgaaattcgtatagataggggagaaacagtaaaa
caattagttagggtaaatgtaaatggagttttacaaaatgctcgtgatgaaaatggtaat
ttgttatatagagaagttaatgacaaaaaagcggatgatgtatttataataccacagtta
caacccgcatcttctgaatggatgaattataaaacacagaagcatcatgatctattagaa
agaataatcaagattttttctaacgaagattcaattgttgctgatttttttgcagggtct
ggtacaactggtgcagtagctgaaagattgggtagacgctggataatgtgtgatatcgga
aaacctgcttgtatgattatgagaaaaagactaatagatcagaacgcaaaaccattttta
tatcaaagtgtaggagattatcaaaaagaagtgtttgcatcgagcaaaatgtttaaaagg
gttggagatttatcacaagttgtgcttggactctatggtgcattaccttttaagcctgag
cagaatccaagcagaaatttaggctacataaaaaatacaagaacacttgtgtatgtagat
tcaccttcaaagcttacaggatataatacattgaaaaaggcgcaggaattgagagaaact
tttcttggtggctgggataaagttatagtgttggggtggaatttcacaatagacataggg
aaggtaataaatgaattgaatgatagtagattggaagttcaagttattcctgcagatttg
ctggataggttaaagaaaacaagttatgaaaaattagtaaaagaaaataaaattagattt
tcaagtttacaatatcttaccataaaacctattcagagaatcgaattagatgcagaaact
gagctgttaaatgtagaactggacaattatattttgttatcaccagatgcattaccgctt
gatgatgaatacaaagaaaaggttcaagaaataatggctaaagatccgcttgcattaata
gaatattggagtattgatcctgattatgatggcgaaatgtttgttagcaaatggcaagat
tatagagaaaacactgacaatgatagtgacccatataaggtggtaacaaaagttcaattg
aaagtccctaaaaaagaaggcaaaagaaaggtttgcgtaaaagccgttgatatatttgga
tttgaaagtgttgttattgaggaggtataa

DBGET integrated database retrieval system