KEGG   Thermoanaerobacter italicus: Thit_1902Help
Entry
Thit_1902         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_25
Motif
Other DBs
NCBI-ProteinID: ADD03140
UniProt: D3T4I8
Position
complement(1955078..1955284)
Genome map
AA seq 68 aa AA seqDB search
MIDCYDADKELLEQKVTEMINKSEDYIRQLEEGDVGRIADINERIFIRFYVTEKSIIIDE
VQEQVYII
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgatagattgctatgatgctgacaaagagttattagaacaaaaggttactgaaatgatc
aataaaagcgaagattatatcaggcaactcgaagaaggagatgttggcagaattgccgat
attaatgaacgaatttttattaggttctatgttacggaaaaaagtataataatagatgaa
gtgcaggaacaggtttatataatataa

DBGET integrated database retrieval system