KEGG   Thermoanaerobacter italicus: Thit_1904Help
Entry
Thit_1904         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD03142
UniProt: D3T4J0
Position
complement(1956282..1956575)
Genome map
AA seq 97 aa AA seqDB search
MKVVIQFCIDADIIDCPEHVIDRLTYYQNEFIDWLFDKKNDHPYWVIENGKKILCCYRSE
AFVEWLNRFVLKDSPQKAAVVEKEITTWDENLPLIFF
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggtgatacaattctgtattgatgcggatataattgactgtccagagcatgta
atagatagacttacatattatcaaaatgaatttattgattggctctttgataagaagaat
gaccatccatattgggtaattgaaaatggcaagaaaatattatgctgctatcgttcggag
gcttttgttgagtggcttaatagatttgttttgaaagattcgccacagaaggcggctgtg
gtagaaaaggaaataaccacttgggatgaaaatctacccttaatatttttttaa

DBGET integrated database retrieval system