KEGG   Thermoanaerobacter italicus: Thit_1906Help
Entry
Thit_1906         CDS       T01178                                 

Definition
(GenBank) glucosamine/fructose-6-phosphate aminotransferase, isomerizing
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00250  Alanine, aspartate and glutamate metabolism
tit00520  Amino sugar and nucleotide sugar metabolism
tit01100  Metabolic pathways
tit01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Thit_1906
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thit_1906
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tit01002]
    Thit_1906
Enzymes [BR:tit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Thit_1906
Peptidases [BR:tit01002]
 Cysteine Peptidases
  Family C44
   Thit_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 SIS_2 GATase_4 Vinculin
Motif
Other DBs
NCBI-ProteinID: ADD03144
UniProt: D3T4J2
Position
complement(1957870..1959696)
Genome map
AA seq 608 aa AA seqDB search
MCGIVGYIGDKQATPILLDGLTKLEYRGYDSAGIAILNDGNINIKKAKGRLNVLKELVEK
DSMAGTIGIGHTRWATHGEPSDTNSHPHLSQSGLIAVVHNGIIENYLPLKKWLLEEGYTF
KSETDTEVVANLLEYYYNGDIVEAVKKVLDRIEGSYALGVLCKNNPDMIVAARKEAPLIV
GIGNGENFIASDIPAILKHTRSVYFLDDNEIAIIRKDSVEFIDMFGRQVEKSLFEVKWDV
EAAEKGGYEHFMIKEIHEQPNAIKDTLRGRIVNDSEIVLDDVKITKEDLEKIDKIFIVAC
GTAYHAGVVGKYVIENLARIPVEVDVASEFRYRNPLVNERTLTIVISQSGETADTIAALK
EAKKKGSRVIAITNVVGSSVSREADDVLYTWAGPEIAVASTKAYTTQLVALYLIAMDLAI
KKETITKTKVMELCTELKKLPEKVQYLLDNKETIQKFAYEHYNAKDVFYIGRGLDYAVAM
EGSLKLKEISYIHSEAYPAGELKHGTLALVEDGTLVIALATQEDLFEKMLSNIKEVKARG
GFILAFAKQGNLQLEDVVDKVIYIPETLKELTPVLTVVPLQLLAYYMAVEKGCDVDKPRN
LAKSVTVE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtagggtatattggcgataaacaggcgacgccaatacttttagatgga
ttgacaaaattagagtatagaggctatgattcggcaggaattgccattttaaatgatggc
aatataaatataaagaaagcaaagggaagattaaatgtcctaaaagagctggttgaaaaa
gatagtatggcaggtaccatagggataggacacacaaggtgggctacccatggagaacca
tctgacaccaactcccatccccatttatcccaatcaggattgattgcagtagttcacaat
ggcataattgaaaactatctgccacttaaaaaatggctattggaagaaggctatactttt
aagtctgagactgatacagaagttgtagcaaatttgctggagtattattacaatggcgat
atagtagaggcagtgaaaaaagttttagacagaattgaaggttcttatgccttgggcgtt
ttatgcaaaaacaatcccgatatgattgtagctgcaagaaaagaagcacctcttatagtt
ggaataggcaatggtgaaaactttattgcatctgatatcccagctatattaaaacataca
agaagtgtatattttcttgatgacaatgagattgccataattagaaaagacagcgtagag
tttatagacatgtttggaaggcaagtagaaaaatcgctttttgaagtaaaatgggatgta
gaggcggctgaaaagggcggttatgaacatttcatgataaaagaaattcacgaacagcca
aacgcgataaaagatactctaagaggtaggatagtcaatgattcagaaatagttttagac
gatgtaaaaattacaaaagaagaccttgaaaagatagataaaatttttattgtagcgtgt
ggaacagcttatcatgcgggtgttgttgggaaatacgttatagaaaatcttgcgagaata
cctgttgaagtagatgtcgcttcagaatttagatatagaaacccattagtaaatgaaaga
actcttacaattgtaataagccagtcaggagagacagcagataccattgctgcattaaaa
gaggctaagaaaaaggggtcaagagttatagccattacaaacgtcgttggaagttctgtc
tcccgagaagcagatgatgtactatatacatgggcgggaccggagattgctgtagcttct
accaaagcttatactacgcaacttgtagccctctatcttatagctatggaccttgcaata
aagaaagaaacgataactaaaacaaaggttatggaactttgtacagaattaaagaagctg
ccagaaaaagttcagtaccttcttgacaacaaagagacaattcaaaaatttgcttatgaa
cattacaacgcaaaagacgttttttacattggaagaggattggactatgctgttgctatg
gaaggttccttaaaacttaaagaaatatcttatattcactcagaagcatatccggctggt
gaattaaaacacggaactttagcccttgtagaagatggaacacttgtgatagctcttgcg
acccaagaggacctttttgaaaagatgctcagcaatataaaagaagtaaaggcaagaggc
ggttttatacttgcttttgcaaaacaaggcaatctgcagctagaggacgttgtagacaaa
gtaatatatatacctgagacacttaaagaattaaccccagtattgacagttgtacctttg
cagcttttggcatattatatggcagtagaaaaaggctgcgatgtagataaaccccgcaat
cttgcaaaatcagttacagtagaataa

DBGET integrated database retrieval system