KEGG   Thermoanaerobacter italicus: Thit_1933Help
Entry
Thit_1933         CDS       T01178                                 

Definition
(GenBank) thymidylate synthase complementing protein ThyX
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thy1 FTCD_C
Motif
Other DBs
NCBI-ProteinID: ADD03168
UniProt: D3T4L6
Position
complement(1981197..1982717)
Genome map
AA seq 506 aa AA seqDB search
MKMRKLTPEEERLLENFVTDVYGPVYFIHSLPEFIIPPINSKVSRRDTSWRLNILESLTD
GDLNITDYIPKHNIPLEKAIQKAKEFHEKWVERFGHSSIAEQHLMHLCVEDVSRLLSGDI
ELMNRRPAFIEWSQRYQKPTRDKVVIPQELEEKPDLKEKFLKVWNNSYDAYEKLVEVLTE
YLARAEEKKEGENEERFYNRISKIAFEDARYALLLATKTSFAVALNALDLQDIVRKLFAH
PTKEAKLLAERIVEQGEKIAPSMLRHTTPTVYQLKVHERLKNLASVVKEDELSDSDEDVI
LIDYTGKDSEDSPVDIVIMHILFTYSGKSFEAVKKTVENMSEEEKRKILQQAVEDIGEFD
HLIEAFKSVRFKFQLKVSEANWHQLLRHRTIVFDYSEPTIENGFVIPPNIEKANASEILI
KAIKASEELFIELKEKLPEVSPYVVTNAHKRLVLMNADLWAFDHFANLRCTNEAQWDIRN
VSFKMLDLIKNVAPQLTTFMARRKKA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgagaaaattaactcctgaagaggagaggcttttagagaactttgtgacagat
gtatatgggcctgtatatttcatacattcattgccggagtttatcattccacctataaat
tcgaaggtaagtagaagagacaccagttggaggcttaatatacttgagtctttgacagat
ggagatttaaacataactgactacatacccaaacacaatatacctttagaaaaagcaata
caaaaggcgaaagaatttcacgagaagtgggtggaaaggtttggacattcttctattgct
gagcagcatttaatgcacctgtgtgtggaagatgtttcaaggcttttgtcaggggatatt
gagcttatgaacagaagacctgcttttatagagtggagccaaaggtatcaaaagcctaca
agagacaaagtagtgataccacaagaattagaagaaaagcccgatttaaaagaaaagttt
ttaaaagtctggaacaactcctatgatgcttatgaaaaacttgtagaagttttgacggaa
tatttagctagggcagaagagaaaaaagagggggaaaatgaagaaagattttacaatagg
attagtaaaattgcatttgaagatgcgagatatgctcttcttttagctactaagacaagt
tttgcagtagctttaaatgctttagatttacaggatatagtgagaaaacttttcgcgcat
cctactaaagaggcgaagttattagccgaaagaatagtagaacaaggtgaaaaaattgca
ccgagcatgttacggcatacaactcctactgtttatcaattaaaagttcatgaaagacta
aaaaatttggcaagtgttgtaaaagaagatgaattatcagattcagatgaggatgtcatt
ttaatcgactatacagggaaagatagcgaagattctcctgtagacattgtaattatgcat
attttgtttacatattcaggtaaaagttttgaagcagtgaaaaaaacagtggagaatatg
tccgaagaggaaaaaagaaaaatcctgcagcaggcagtcgaagatataggggaatttgac
catttaatagaggcatttaaatcggtcagatttaaatttcaattaaaggtaagtgaagct
aattggcatcagcttttacggcatagaactattgtctttgattacagcgaaccgacaatt
gaaaatggttttgttattcctcccaatattgaaaaagctaatgcttccgaaattttaata
aaagcgataaaagcttcagaggaattatttatagaattaaaagaaaaattacctgaagta
agtccttacgtagttacaaatgcacacaaacggttggttcttatgaatgcggatttatgg
gcttttgatcattttgcaaatttgagatgcactaatgaagctcagtgggatatacggaat
gtttcttttaagatgcttgatttgattaaaaatgtagcgccccaattgacaacctttatg
gcaaggcgaaaaaaagcttaa

DBGET integrated database retrieval system