KEGG   Thermoanaerobacter italicus: Thit_1938Help
Entry
Thit_1938         CDS       T01178                                 

Definition
(GenBank) ribosomal protein L13
  KO
K02871  large subunit ribosomal protein L13
Organism
tit  Thermoanaerobacter italicus
Pathway
tit03010  Ribosome
Module
tit_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tit00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thit_1938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tit03011]
    Thit_1938
Ribosome [BR:tit03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Thit_1938
  Bacteria
    Thit_1938
  Archaea
    Thit_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L13 DUF3659
Motif
Other DBs
NCBI-ProteinID: ADD03173
UniProt: D3T4M1
Position
complement(1992880..1993311)
Genome map
AA seq 143 aa AA seqDB search
MKSYMAKPEDVERKWFVIDAEGKVLGRLASQIAKILMGKHKPTYTPHVDTGDFVIVLNAD
KIVLTGNKLEDKYYKYYTGYPGGLKEVQYKKLMQTKPEFVIYHAVKGMLPKNRLGRRMIK
RLKVYRGSEHKHQAQKPEKLDIE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatatatggctaaacctgaagatgttgaaagaaaatggtttgttatagatgct
gagggtaaagttttaggaaggttagcaagccaaatcgctaaaatactaatgggtaagcat
aaaccaacttacacacctcatgtagatacaggagattttgtaatagttttgaatgctgac
aaaattgtgttgacaggcaataaattagaagataaatattacaagtattatacgggatat
ccaggaggattaaaagaggttcaatataaaaaattaatgcagacaaaacctgagtttgtg
atataccatgctgtaaaaggcatgttgcctaaaaatagacttggacgcagaatgattaaa
agattgaaagtatatagaggctctgagcataaacatcaagctcaaaagcccgaaaaatta
gatatagaatga

DBGET integrated database retrieval system