KEGG   Thermoanaerobacter italicus: Thit_1942Help
Entry
Thit_1942         CDS       T01178                                 

Definition
(GenBank) ABC transporter related protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit02010  ABC transporters
Module
tit_M00582  Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:tit00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Thit_1942
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tit02000]
    Thit_1942
Enzymes [BR:tit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     Thit_1942
Transporters [BR:tit02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter [MD:M00582] [OT]
    Shared module
     Thit_1942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_24 AAA_29 AAA_22 AAA_15 TniB AAA_18 AAA_23 ATPase RNA_helicase MeaB AAA_14 AAA_5 AAA_16 RsgA_GTPase NB-ARC AAA_33 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ADD03177
UniProt: D3T4M5
Position
complement(1995787..1996620)
Genome map
AA seq 277 aa AA seqDB search
MEHIITTQNLSFEYHTEEQTRHLVLKDINLQFKKGQFIGIIGHNGSGKSTLAKHFNALLV
PTEGKVYVKGMDTKDAKHLWDIRQTAGLVFQNPDNQIVAAIVEEDVAFGPENLGISPDEI
KERVEYALKAVGMWEYKDYPPHMLSGGQKQRVAIAGIIAMKPECIILDEPTAMLDPIGRR
EVISTIKKLNKEEEITVILITHFMEEVVDADRVIVMDDGKVVLDGTPKEVFKEVELLKKI
GLSVPQVTELAYQLKREGFDVPLDILTVEEMVEFLCR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaacacataataacaacacaaaatttatcttttgaatatcatacagaagaacaaact
cgacacctagttttaaaggatataaatttacagtttaaaaaaggacagttcataggtata
attggccataatgggtcaggcaaatcaacacttgccaaacactttaatgcacttttagtg
ccgacagaggggaaagtgtatgtaaagggaatggacacgaaagatgcaaagcatttatgg
gacataagacagactgctgggcttgtttttcaaaatccagataatcaaatagtggcggct
atagttgaggaggatgtagcttttggcccagaaaatttaggtatatcccctgatgagata
aaagaaagagttgaatatgctcttaaagcagtaggtatgtgggaatacaaagattatcct
ccccacatgctttcaggcggccaaaagcaaagagttgccattgctgggataattgcaatg
aagccagagtgcataattttagatgagccaacggcaatgcttgacccaataggaagaagg
gaagtaatttctaccataaaaaaactcaacaaagaagaggaaattactgtaatactcata
acacattttatggaggaagtagtagatgcagatagagttattgtaatggatgatggaaag
gtagtgttagatggtactcctaaagaggtatttaaagaagttgagcttttaaaaaagatt
ggcctcagtgtgccccaagttacagagttggcataccaattgaagagagaaggctttgac
gtccctctagacattttaacagtagaagaaatggtggaatttttatgccgataa

DBGET integrated database retrieval system