KEGG   Thermoanaerobacter italicus: Thit_1945Help
Entry
Thit_1945         CDS       T01178                                 

Definition
(GenBank) ribosomal protein S4
  KO
K02986  small subunit ribosomal protein S4
Organism
tit  Thermoanaerobacter italicus
Pathway
tit03010  Ribosome
Module
tit_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tit00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thit_1945
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tit03011]
    Thit_1945
Ribosome [BR:tit03011]
 Ribosomal Proteins
  Bacteria
   Small subunit
    Thit_1945
  Archaea
    Thit_1945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S4 S4
Motif
Other DBs
NCBI-ProteinID: ADD03180
UniProt: D3T4M8
Position
complement(1998052..1998672)
Genome map
AA seq 206 aa AA seqDB search
MGRYLGPSCRLCRREGMKLYLKGDKCYTDKCPVVRRGYAPGQHGQERKKLTSYGIQLREK
QKLKRYYGLLERQFERFYEKAERMKGITGENLLQLLERRLDNVVYRLGFAVSRRQARQLV
SHGHIEVNGKKVDIPSFLVKPGDVISVREKSRSMELIKNNLEAARNVPDWLELNKDAFEG
RVVSLPRREHIDLPIQEHLIVELYSK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgggaagatacttaggaccaagttgcagattgtgcagaagagaaggtatgaaattatat
ttaaaaggagataaatgttatacagacaaatgtcctgttgtaagaagaggatatgcacca
gggcaacatgggcaagaaaggaaaaaacttactagctatggcatacaactaagagaaaaa
caaaaactcaaaagatactatggccttttagagagacagtttgaaaggttctatgaaaaa
gcagaaagaatgaaaggaattacaggtgaaaacttattgcaacttttagaaagacgtctt
gacaatgtggtatacagattaggttttgcagtttctaggcgacaagcgaggcaattggta
agccatggccatatagaggtcaatggcaagaaagttgatataccatctttcttagtaaaa
ccaggggatgtaatatctgtgagggaaaaaagccgttcaatggaattgataaagaacaat
ttagaagctgcgaggaacgtacctgactggctagaactcaataaagatgcttttgaaggt
agagtggtttcattgccgagaagagaacatatagatctgcctatacaagagcacttgatt
gttgagttgtattctaagtaa

DBGET integrated database retrieval system