KEGG   Thermoanaerobacter italicus: Thit_1950Help
Entry
Thit_1950         CDS       T01178                                 

Definition
(GenBank) conserved hypothetical protein
Organism
tit  Thermoanaerobacter italicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2833 DUF1002 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ADD03185
UniProt: D3T4N3
Position
complement(1999850..2000116)
Genome map
AA seq 88 aa AA seqDB search
MDDWQIGQVVRSKAGRDKGRVFVIVGKFDDQHVFVADGDLRTIEKPKKKKFKHLQRYNDV
IWQIKEKILNGDKLTNEEIRKFLEPYKS
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggacgactggcaaattggtcaggtagtacggagcaaagcaggtcgtgataaaggtaga
gtttttgttattgtaggaaaatttgatgaccaacatgtttttgtagccgatggggacctt
cgaacaatagaaaaacctaagaaaaaaaagtttaaacatcttcaacggtataatgacgta
atttggcagattaaagaaaaaatcttaaatggcgataaattaactaatgaagaaattaga
aaatttttagagccttataaatcctaa

DBGET integrated database retrieval system