KEGG   Thermoanaerobacter italicus: Thit_1953Help
Entry
Thit_1953         CDS       T01178                                 

Definition
(GenBank) preprotein translocase, SecY subunit
  KO
K03076  preprotein translocase subunit SecY
Organism
tit  Thermoanaerobacter italicus
Pathway
tit02024  Quorum sensing
tit03060  Protein export
tit03070  Bacterial secretion system
Module
tit_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:tit00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Thit_1953
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Thit_1953
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Thit_1953
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tit02044]
    Thit_1953
Secretion system [BR:tit02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Thit_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecY
Motif
Other DBs
NCBI-ProteinID: ADD03188
UniProt: D3T4N6
Position
complement(2001546..2002802)
Genome map
AA seq 418 aa AA seqDB search
MFQTLVNAWKVDDIRRRILYTVVMLIIFRLGSHIPVPGIDSKVIANILGQGQLFGFFDII
SGGAFSSFTIFAMSITPYINASIIMQLLTIAIPSLEQMAKEGEEGRKKIAQYTRYLTVVL
ALIQAIGMTIGLRRAVINPTFFNLTVIVITLTAGTAFLMWLGERITENGIGNGSSLIIFA
GIISRIPNMIYMTAEYVRAGTANIFGAIAFVVAELLMIVLIILATEGQRRIPVQYAKRVV
GRKVYGGQSTHIPIRINMAGVIPIIFALSLLQFPQQLATFFPRSSFYNFVQRWLSTSGLI
YNILDILLIIGFTYFYTAVIFNPVEISDNLKKYGGFIPGIRPGRPTTEYLTKILNRITFV
GALFLAFIATMPVILMRITGLQLYFGGTALLIAVGVALDTMKQVEGHLIMRNYQGFLK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgtttcaaacccttgtcaatgcttggaaggttgatgatataaggagaagaatactttat
actgtagttatgttaataatctttagattggggtctcatatccccgtgccaggaattgac
tcaaaggttattgctaatatacttggccaaggacaattgtttggattttttgatataata
tcaggtggtgcttttagtagctttaccatttttgcgatgagcattacaccctacatcaat
gcatcaattataatgcaacttttaacaatagcaattccctctcttgaacaaatggcaaaa
gaaggggaagagggaaggaagaaaattgctcagtataccagatatttaacagtggtgctt
gccttgatacaagctataggaatgacaattgggctaaggagggcagttatcaatcctaca
ttttttaacttgacggtcattgttataactttgacggcaggtactgcttttctgatgtgg
ttgggtgaaagaattacggaaaatggaataggcaacgggagttcattgataatttttgcg
gggataatttctaggattcctaacatgatatatatgacagctgaatatgttcgtgcgggt
actgctaatatttttggtgctattgcttttgtagttgcagagcttctaatgatagtgtta
ataattttagccacagaaggccaaagaagaattcctgtgcaatatgcaaaaagggttgtt
ggaagaaaagtttatggtgggcaaagtactcacattcctataagaataaacatggcaggg
gttattcctattatatttgctctttcactgttacaatttccacaacaattagctaccttt
tttccacggtcgtcattttataactttgtacaaaggtggctaagcacaagtgggctaata
tacaatattttagatatattattgataattggatttacttatttctatacagcagtaata
tttaatccggtagagatttcagataacttaaaaaaatatgggggttttattcctggcata
agaccaggtagaccgactactgaatatcttacaaagatattgaacagaattacttttgta
ggagcgttattcttggcatttattgctacaatgccagtaattttaatgagaataactgga
ttgcagctttattttggaggcacagctcttttaattgcagttggtgtagcgcttgatact
atgaaacaagtagaagggcaccttatcatgaggaattatcaaggatttttgaagtaa

DBGET integrated database retrieval system