KEGG   Thermoanaerobacter italicus: Thit_1956Help
Entry
Thit_1956         CDS       T01178                                 

Definition
(GenBank) ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
tit  Thermoanaerobacter italicus
Pathway
tit03010  Ribosome
Module
tit_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tit00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Thit_1956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tit03011]
    Thit_1956
Ribosome [BR:tit03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Thit_1956
  Bacteria
    Thit_1956
  Archaea
    Thit_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L18p RraA-like DUF4483
Motif
Other DBs
NCBI-ProteinID: ADD03191
UniProt: D3T4N9
Position
complement(2003797..2004165)
Genome map
AA seq 122 aa AA seqDB search
MMIKKPNRNELRKRRHLRIRKKVFGTPERPRLNVFKSLKHIYAQIIDDTKGHTLVHASTL
DPELRSIAKGANKQSAKLVGELIAKRALEKGIKDVVFDRGGYIYHGVVKELADAARQAGL
NF
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgatgattaaaaaaccaaataggaatgaattaagaaaaagacgccatttgaggataaga
aagaaggtttttggtacaccagaaagaccacgtcttaatgtgtttaaaagtctaaaacat
atttatgcgcaaattatagacgatactaaagggcatactcttgttcatgcttctacgcta
gatcctgagcttagaagcattgcaaaaggagcaaataagcagtctgctaaattggtagga
gagttgattgcaaagagagctttagaaaaaggcataaaggatgttgtatttgacaggggt
gggtatatttatcatggggtagtaaaagaattggcagacgctgcacgacaagcaggattg
aatttctaa

DBGET integrated database retrieval system