KEGG   Thermoanaerobacter italicus: Thit_1989Help
Entry
Thit_1989         CDS       T01178                                 

Definition
(GenBank) preprotein translocase, SecE subunit
  KO
K03073  preprotein translocase subunit SecE
Organism
tit  Thermoanaerobacter italicus
Pathway
tit02024  Quorum sensing
tit03060  Protein export
tit03070  Bacterial secretion system
Module
tit_M00335  Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:tit00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Thit_1989
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Thit_1989
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Thit_1989
Secretion system [BR:tit02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Thit_1989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecE SPT_ssu-like
Motif
Other DBs
NCBI-ProteinID: ADD03224
UniProt: D3T4T1
Position
complement(2030533..2030730)
Genome map
AA seq 65 aa AA seqDB search
MAGEGRKFVKFFKDVRAEMKKVTWPSKESMITYTEIVLIAMVFFTVFIFLIDSVFSYLLK
LIIKV
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgaaggaagaaaatttgtcaaattttttaaagatgtaagggcagaaatgaaa
aaggtgacatggccaagtaaagaaagcatgataacttacactgaaattgtactaatagca
atggttttttttacagtattcatttttttaattgactcagtttttagttatcttttaaag
ctcattattaaagtttaa

DBGET integrated database retrieval system