KEGG   Thermoanaerobacter italicus: Thit_1991Help
Entry
Thit_1991         CDS       T01178                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
tit  Thermoanaerobacter italicus
Brite
KEGG Orthology (KO) [BR:tit00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tit03012]
    Thit_1991
   03029 Mitochondrial biogenesis [BR:tit03029]
    Thit_1991
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tit04147]
    Thit_1991
Translation factors [BR:tit03012]
 Eukaryotic Type
  Elongation factors
   Thit_1991
 Prokaryotic Type
   Thit_1991
Mitochondrial biogenesis [BR:tit03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Thit_1991
Exosome [BR:tit04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Thit_1991
  Exosomal proteins of breast cancer cells
   Thit_1991
  Exosomal proteins of colorectal cancer cells
   Thit_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase Peptidase_U32_C Lentivirus_VIF
Motif
Other DBs
NCBI-ProteinID: ADD03226
UniProt: D3T4R9
Position
complement(2031042..2032244)
Genome map
AA seq 400 aa AA seqDB search
MAKQKFERTKPHVNVGTIGHVDHGKTTLTAAITMVLSNAGLAEKKGYDEIDKAPEERARG
ITINTTHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDAELIELVEMEVRELLNEYEFPGDDTPIVVGSALKALE
CGCGKRECEWCGKIWQLMDVVDEYIPTPERDIDKPFLMPVEDIFTITGRGTVATGRVERG
KVKVGDEVEIIGLTTESKKTVVTGVEMFRKTMDEAQAGDNIGVLLRGIQRDEVERGQVLA
KPGTIKPHMKFEGQVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGTIQLPEGVEMVMPG
DHVTIKVELITPIAMEEGLKFAIREGGRTVGAGVVSAIIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaaaaatttgagaggacgaaaccgcatgtaaatgtagggacgatagggcac
gtagaccatggtaagacgacattaacagcggcgataacgatggtattatccaatgcaggg
ttagcagagaagaaaggatatgacgagatagacaaggcaccggaggagagagcaagggga
ataacaataaacacgactcacgtagaatatgagacagagaagaggcactatgcgcatgta
gactgtccaggtcacgcggactacgtaaagaacatgataacaggtgcagcacagatggac
ggagcgatattggtagtatcagcagcagacggtccgatgccacagacgagggagcacata
ttattagcgaggcaggtaggagtgccatatatagtagtatttttaaacaaggcagacatg
gtagacgatgcagaattaatagagctggtagagatggaagtaagggagttattaaacgaa
tatgaatttcctggggatgacacaccgatagtagtaggttcagcattaaaggcattagaa
tgtggatgtggcaagagagaatgcgaatggtgcgggaagatatggcagttaatggatgta
gtagacgaatatataccgacaccggagagggacatagacaagccatttttaatgccagta
gaggacatatttacaataacgggaagagggacagttgcgacagggagagtagagagaggc
aaagtaaaagtaggggacgaagtagagataatagggcttacgacagaatctaagaagaca
gtagtgacaggggtagagatgttcaggaagacgatggacgaagcgcaagcaggggacaac
ataggagtgttattaagagggatacagagggacgaagtagagagagggcaagtattggcg
aagccagggacgataaagccgcacatgaaatttgaggggcaggtatacgtattgacgaag
gaagaaggaggaaggcatacaccatttttcaatggatacaggccacaattttactttagg
acgacagacgtaacagggacgatacagttaccagagggagtagagatggtgatgccgggg
gaccacgtaacgataaaagtagagttaataacaccgatagcgatggaagaaggtttgaag
tttgctataagagaaggcggccgtacagtaggtgctggcgtcgtgtcagctatcatagag
taa

DBGET integrated database retrieval system