KEGG   Thermoanaerobacter italicus: Thit_1993Help
Entry
Thit_1993         CDS       T01178                                 

Definition
(GenBank) protein of unknown function DUF901
  KO
K06962  uncharacterized protein
Organism
tit  Thermoanaerobacter italicus
Brite
KEGG Orthology (KO) [BR:tit00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Thit_1993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NYN_YacP DUF4445 DUF188
Motif
Other DBs
NCBI-ProteinID: ADD03228
UniProt: D3T4T5
Position
complement(2033246..2033746)
Genome map
AA seq 166 aa AA seqDB search
MYMLVDGYNVINNWQILKREAQKSLEDARDKLIDILADFKGYSGINIILVFDAMYVKGSL
EKHEEISGIEVVYTKEGESADHFIELKVVELAKKERVIVVSSDWTVQQVVLAHGAIRMSA
RELYEEMNKYIESHKKSYMNTIYKDNLEERLDSEIVKKLRKMAENS
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgtatatgttagtagatggttataatgtgataaataattggcagattttaaaaagagaa
gcgcaaaaaagcttggaagatgcgcgagataagttaatagatatattggctgattttaaa
ggatattcagggataaatataatcttagtttttgacgcaatgtatgtaaaaggaagttta
gaaaaacatgaagaaattagtgggattgaagtcgtttacacaaaagaaggtgaatcggca
gatcactttatagagttaaaagtggtggaattagcgaaaaaggagcgagtaattgtggta
agttctgattggactgtgcaacaggtggttttagctcatggtgcaataagaatgtctgcg
agagagctttacgaggagatgaacaaatatattgaaagccataaaaaaagctatatgaat
acaatttataaagacaatttggaagaacgtttagatagtgaaatagtaaaaaagctgcgc
aaaatggcagaaaacagctaa

DBGET integrated database retrieval system