KEGG   Tenacibaculum jejuense: TJEJU_1369Help
Entry
TJEJU_1369        CDS       T05041                                 

Gene name
aceB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00620  Pyruvate metabolism
tje00630  Glyoxylate and dicarboxylate metabolism
tje01100  Metabolic pathways
tje01110  Biosynthesis of secondary metabolites
tje01120  Microbial metabolism in diverse environments
tje01200  Carbon metabolism
Module
tje_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TJEJU_1369 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    TJEJU_1369 (aceB)
Enzymes [BR:tje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TJEJU_1369 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI YdaS_antitoxin
Motif
Other DBs
NCBI-ProteinID: SNR15103
UniProt: A0A238U7E5
Position
TJEJU:1469347..1470942
Genome map
AA seq 531 aa AA seqDB search
METKAMLNEIQFKGFEEQSYQSILTPEAKVFLVELHNRFNAKRLELLKERVKMQVYFDEG
NFPSFPEETASIRNSDWVCKPLPQDLLDRRVEITGPVDRKMVINALNSGAKTFMADFEDS
NAPTISNILNGQQNLFDANTKTISFYNEKKDKTYQLNEETALLLVRPRGLHLNERHFVVD
GEEMSGSLVDFGLYFFHNIKVLQEQGSATYFYLPKLEHYLEARWWNEVFVFAQDYLGIAQ
DTIKATVLVETITASFQLDEIIYELKDHMAGLNCGRWDYIFSYIKKFRNHEGFLVPDRAQ
VTMSSPFMKAYSQRVVQRCHVRRVHAMGGMAAQIPVKNNEEANSAAYAKVERDKLQEVKN
GHDGTWVAHPALVKVAMDVFNEHMPTPNQIDNKREDLVVTEEELVELPTGTVTEKGIREN
INVGILYIESWLSGNGAAALYNLMEDAATAEISRTQIWQWLHKGVRLEDERAFDIEMYNE
FKAQEVEKIKELVGEAAFTSRRFELAIQLFDDLVLSEDFEEFLTLPAYKYI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaagcaatgttaaatgagattcaattcaaaggatttgaagaacagtcttat
caatcaattttaactccagaagctaaagtttttttagtcgagttacacaataggtttaat
gctaaaagattggagttgctaaaggaaagagtcaagatgcaagtgtattttgatgaagga
aattttccttcgtttccagaagaaacagcttcaataagaaattcagattgggtttgtaaa
cctttgcctcaagatttattagatagaagagttgagattacaggtccggttgatagaaaa
atggtgattaacgctttaaattctggtgctaaaacttttatggcagattttgaagatagt
aatgctccaacaatttctaatatattaaatggtcagcaaaatttatttgatgctaatacg
aaaacgatttcgttctacaatgaaaagaaagataaaacgtatcagttgaatgaagaaaca
gcattattgttagtaagacctagaggtttacatttaaatgaaagacattttgtagttgat
ggagaagagatgtcgggttctttagttgatttcggattgtacttctttcataatattaaa
gtattacaagaacaaggttcagcaacttatttttatttgccaaaattagaacattattta
gaagctcgttggtggaatgaagtttttgtttttgcgcaagattatttaggtattgctcaa
gatactatcaaagctacagttcttgttgaaacaattacagcaagttttcaattagatgaa
attatatacgaattaaaagatcatatggctgggcttaattgtggtcgatgggattacatc
ttctcttatataaagaagtttagaaatcatgaagggtttttagttccagatcgtgctcag
gtaacaatgagctcgccatttatgaaagcatattctcaacgtgtagttcaacgttgtcat
gtaagaagagttcatgcaatgggaggaatggcagcgcaaattcctgttaaaaataatgaa
gaagcaaacagtgcagcttatgcaaaagtagagcgtgataaacttcaagaagtaaaaaat
ggtcacgatggaacttgggttgcacatccagctttagtaaaagtagctatggatgttttc
aatgaacacatgccaactccaaatcaaattgacaacaagcgtgaagatttagtggttaca
gaagaagagttagttgaattaccaacaggaactgtaactgaaaaaggaattcgtgagaat
atcaatgtgggtattttgtatatcgaaagttggttgtcaggaaatggagcagcagcatta
tataatttaatggaagatgcagcaacggcagaaatttcaagaacacaaatttggcaatgg
ctacacaaaggagttcgattagaagacgaaagagcttttgatatagaaatgtacaacgag
tttaaagctcaagaggtagaaaaaattaaagaattagttggtgaagcggcttttacttct
agaagatttgaattagcaattcaattgtttgatgacttagtgttgtcagaagactttgaa
gaatttttaaccttaccagcgtacaaatacatatag

DBGET integrated database retrieval system