KEGG   Tenacibaculum jejuense: TJEJU_1853Help
Entry
TJEJU_1853        CDS       T05041                                 

Gene name
ltaE
Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00260  Glycine, serine and threonine metabolism
tje01100  Metabolic pathways
tje01110  Biosynthesis of secondary metabolites
tje01120  Microbial metabolism in diverse environments
tje01130  Biosynthesis of antibiotics
tje01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TJEJU_1853 (ltaE)
Enzymes [BR:tje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     TJEJU_1853 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: SNR15559
UniProt: A0A238U8P3
Position
TJEJU:2024025..2025059
Genome map
AA seq 344 aa AA seqDB search
MQVNLISDTVTKPTEGMLKAMMNANVGDDVFKGDPTVNLLQEKVADMFGMEDALFFPSGT
MANQTAIKLHTQPGDKLFCDKWAHVYNYEGGGAAFNAGVSCKLIDGDRGMFTADQLQYAA
EGRSDIHVPYSRLVCIENTTNKGGGACWDFEELKNIKKVSDQFNLSYHLDGARLFNALVE
KNETPKQYGELFDTISICLSKGLGAPIGSVLVGSKEHMEKALRIRKLFGGAMRQVGYLAA
AGIYALDHHVIRLQEDHQKAKEIGETLAQLSYVKKVEPIETNIVIFYVNENINANDFIKD
MEDKGILLIPMGEGKIRIVTHLDYTDKMHKILLQALQNYQMLKF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaatttaataagcgatactgttactaaacctacagaaggaatgttaaaagca
atgatgaatgctaatgtaggtgatgatgtatttaaaggagatccaactgtaaacctattg
caagaaaaagtagcagatatgtttggaatggaagatgctttattttttccttcaggaaca
atggctaatcaaacagcaataaaactacatacacaaccaggagataaattgttctgtgac
aaatgggctcatgtatacaattatgaaggtggaggagccgcttttaatgctggagtatct
tgtaagttaattgacggagatagaggaatgtttacagctgatcaattgcaatatgctgct
gaaggaagatcggatattcatgttccatattctcgattagtttgtattgaaaatactacc
aataaaggtggaggagcttgttgggattttgaagaattgaaaaacattaaaaaagtttca
gatcagtttaacttaagttatcatttagatggagcaagattatttaatgctcttgtagag
aagaatgaaacacctaaacaatacggagagttatttgatacaatttctatatgcttatct
aaaggtctaggtgcgccaattggttctgttttagtgggatctaaagaacatatggaaaaa
gctttacgtattagaaaattatttggaggagctatgcgacaagtaggatatttagctgca
gcaggaatttatgctttagatcatcatgtaatacgtttgcaagaagatcatcaaaaagca
aaagaaataggtgagaccttagctcaattatcttacgttaaaaaagtagagccaattgaa
actaatattgttatcttttatgttaacgaaaatattaatgccaatgattttattaaagat
atggaagacaaaggaattttattaattcctatgggcgaaggaaaaatcagaattgtaaca
catttagattatacggataaaatgcataaaattttgttacaagctttacaaaactatcaa
atgttaaagttttaa

DBGET integrated database retrieval system