KEGG   Tenacibaculum jejuense: TJEJU_3628Help
Entry
TJEJU_3628        CDS       T05041                                 

Definition
(GenBank) Alpha-ketoglutaric semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
tje  Tenacibaculum jejuense
Pathway
tje00040  Pentose and glucuronate interconversions
tje00053  Ascorbate and aldarate metabolism
tje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tje00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TJEJU_3628
   00053 Ascorbate and aldarate metabolism
    TJEJU_3628
Enzymes [BR:tje01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     TJEJU_3628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2229 DUF1944
Motif
Other DBs
NCBI-ProteinID: SNR17270
UniProt: A0A238UFX5
Position
TJEJU:complement(4053778..4055355)
Genome map
AA seq 525 aa AA seqDB search
MITGKNHIGNQLSSLGTVRFKTINPELNKENEFEYFQATEEEINQAVDKAEEAFHSYKNY
SGKQKAEFLRTIADEIESLGGDLINTYCSETGLPTGRAIGERGRTVFQLRSFADLVEEGS
WVEASIDTGIPDRTPAPKPDLRKMSIPLGPVVVFGASNFPLAYSTAGGDTAAALASGCPV
IVKSHPMHAGTGELIATAIVKAAEKTGMPNGVFSNINAKDYSAGQQLVSHPKIKAVGFTG
SIKGGRALLDIAAKREEPIPVFAEMGSINPVVLLPKALENRRNEIANTYAGSITLGTGQF
CTNPGLILGIAGEELSGFIEELGSKIKEINPSCMLHPNIHGAYEKGKQQAMNQNDVTIVA
NLDEEIQTNYASQLVATVSGKTFLENSTLHHEVFGPFSIVVQCENLEQLEEIISSLEGQL
TGTIISDDNEISNYSELVAKMQNRVGRLIFNGVPTGVEVCPSMVHGGPYPASTDSRFTAV
GVNSIKRWVRPFSYQNWPNELLPDELKDENPLGISRIVNGQTNQV
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgattactggaaaaaatcatataggaaatcaattgtcttctttaggaactgttagattt
aaaaccataaatccagaattaaataaagaaaacgagtttgaatattttcaggcgactgag
gaagagataaatcaagctgtagataaagcagaagaagcttttcatagttataaaaattat
tctggaaaacaaaaagctgagtttttaagaacaattgctgacgagatagaaagcttagga
ggcgatttaataaacacatattgttctgagacaggtttacctacaggaagagctattggt
gaaagaggaagaacagtttttcaattacgctcttttgcagatttagtagaagaaggttct
tgggtagaagcttctatagatactggaattccagatagaactccagcaccgaaaccagat
ttaagaaaaatgagtattccacttggtcctgttgtggttttcggagcaagtaattttcca
ttagcgtattctacagccggtggagatacagcagcagctttagcttccggttgcccagta
attgtaaaatcacatccaatgcatgcaggaacaggagagttaattgcaactgcaattgtg
aaagctgctgaaaaaacaggaatgccaaatggagttttttcaaatattaatgcgaaagat
tattcagcgggacaacaattagtgagtcatccaaaaataaaagcagttggatttactgga
agtattaaaggaggaagagctttactagatattgcagctaaacgagaagaaccaattcct
gtttttgcagaaatgggaagtataaatccagtggttttattaccaaaagcattagaaaat
agaaggaatgaaatagcaaatacatatgcaggatctataacattaggaacaggacaattt
tgtacaaatcctggtttgattttaggaattgcgggagaggaattgtctggttttattgaa
gaattaggatcaaaaattaaagaaataaatccttcttgtatgttacatccaaacattcat
ggagcttacgagaaaggaaagcaacaagcgatgaatcaaaacgatgtaacgattgtggct
aatttagatgaagagattcaaacgaattatgcttctcaactagttgcaaccgtttccgga
aaaacgtttctagaaaattcaacgttacatcacgaagtttttggtccattttcaattgta
gttcaatgtgaaaatttggaacagttagaggagattatttcaagtttagaaggacagcta
acaggaactatcatttcagatgacaatgaaatttcgaactattctgagttagttgcgaaa
atgcaaaacagagtaggacgattaatttttaatggagttccaactggagttgaagtatgt
ccttcgatggtacatggcgggccgtatcctgcttctacagatagtcgttttaccgcagtt
ggtgtgaattctataaaacgttgggttcgtccatttagttatcaaaattggccaaatgag
ttattaccagacgaattaaaagatgaaaatccattaggaatttcacgaatagtaaacgga
caaacaaaccaagtttaa

DBGET integrated database retrieval system