KEGG   Tenacibaculum jejuense: TJEJU_3729Help
Entry
TJEJU_3729        CDS       T05041                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
tje  Tenacibaculum jejuense
Brite
KEGG Orthology (KO) [BR:tje00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    TJEJU_3729 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: SNR17366
UniProt: A0A238UED5
Position
TJEJU:4157660..4158046
Genome map
AA seq 128 aa AA seqDB search
MFQQITKGIKISVKTTYNGTIYRGYMQHYAFSYFVTIKNTSNETVQLLERFWTIYDALNN
TEYVEGEGVVGQMPIIKPNEEYNYRSNCFLLSSIGSMTGKYKMKNTETLEEFLVNIPTFQ
LTTTPTLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaacagatcacaaaaggaattaaaatatcagttaaaaccacatataacggtaca
atatacagaggatatatgcaacattatgccttcagttattttgttactataaaaaatacg
tctaatgaaaccgtacagttacttgaacgtttttggacaatctatgatgctttaaataat
actgaatatgtggagggagaaggtgttgtaggacaaatgccaataataaaacctaatgaa
gaatacaattacagatctaactgttttctactttcttcgataggatcaatgacaggaaaa
tataaaatgaaaaatacagaaactcttgaagagtttttagtaaacatacctacttttcaa
ctaactactacaccgacgctaaattaa

DBGET integrated database retrieval system