KEGG   Thermincola potens: TherJR_0094Help
Entry
TherJR_0094       CDS       T01226                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tjr  Thermincola potens
Pathway
tjr00450  Selenocompound metabolism
tjr00970  Aminoacyl-tRNA biosynthesis
tjr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TherJR_0094
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    TherJR_0094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tjr01007]
    TherJR_0094
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tjr03016]
    TherJR_0094
Enzymes [BR:tjr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     TherJR_0094
Amino acid related enzymes [BR:tjr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   TherJR_0094
Transfer RNA biogenesis [BR:tjr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    TherJR_0094
 Prokaryotic type
   Other AARSs
    TherJR_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f DNA_ligase_ZBD Borrelia_lipo_1 Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: ADG80990
UniProt: D5X8Z0
Position
100264..102207
Genome map
AA seq 647 aa AA seqDB search
MKKTFYITTPIYYPSDNLHIGHAYTTVAADTIARYKRMTGYDVRFLTGSDEHGQKIERTA
KARGVEPIDYVDRIVAGFKNLWRHLDVHYDDFIRTTEPRHKEVVQKIFTRLYEQGDIYKS
EYEGLYCTPCETFWTERQAEEGNCPDCGRPVERVREESYFFRMSKYADRLLRYIEENPDF
IQPVSRRNEMVNFIKQGLEDLCVSRTTFDWGIKVPFDPKHVVYVWVDALTNYISALGYGT
ENDELYKKYWPADVHLVGKDIVRFHTIIWPILLMAIGEPLPKKVMGHGWLLLEGGKMSKS
KGNVIDPLVLIDKYGVDAIRYYLLRELPFGSDGYYAEEALIQRINSDLANDLGNLISRTI
AMVEKYFNGMVQAPTEKEEIDEDLRQLAMVTVEDYRNQMEKLELSNALASIWKLIGRANK
YIDETAPWILAKDEAKRPRLGTVLYNLLEVIRIVTVLVSPFMTRLPDKVWVQCGLSGKEE
CTTWESVQNWGRFPADINVKRGEALFPRIEVKKEREAVEEKDNTAIQAATKEEPAGEKQY
ITIEEFARIDLRLAEIVKAEKVEKADKLVKLEVALGEERRTIVAGIAQHYSPDELIGKKI
VVVANLKPAKLRGILSEGMLLAASHDGNLGVLTIDPGKEVPSGAKVK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccttttatatcacaacgccgatctattatcccagtgataacttgcacatt
ggccatgcctataccacggtggctgccgatactattgcccggtataaacggatgacgggt
tatgacgtgcgctttcttaccggaagtgacgagcatggccaaaaaattgagcgtaccgcg
aaagcccgcggagttgagccgattgattatgtggacagaattgtggccgggtttaaaaac
ctctggcgccacttggatgttcattatgatgattttatcaggacaacagaaccgcggcac
aaggaagtggtacagaaaatatttacccgcctttatgaacagggagatatttacaaatca
gagtacgagggtttatactgcactccctgtgaaacattttggacggagcggcaggctgag
gaaggaaactgccctgattgtgggcgcccggtagaaagggtcagggaggaaagttatttc
ttcagaatgtccaaatatgctgaccggcttctccggtatattgaagaaaaccctgatttt
attcagcctgtttcgcggcgcaacgaaatggttaactttatcaaacaggggctggaagac
ctttgtgtatcaaggaccacttttgactggggcattaaggttcccttcgaccctaaacat
gtggtttatgtttgggttgatgctctcactaactatatttccgcccttggatacggcacc
gaaaacgacgagctttacaaaaagtactggcctgccgatgttcacttggtaggaaaggat
attgtccgttttcatacgattatatggccgatattattgatggctatcggcgagcctttg
ccgaaaaaggttatgggccatggctggctactcctggaaggcggcaaaatgtccaagtca
aaggggaatgttatcgaccctcttgttctcatagacaaatatggggttgacgctatccgg
tattatttgctgagagaacttccttttggttcggacgggtactatgccgaagaagcttta
atacaaaggataaattccgacttggccaatgacctggggaacttgatttccaggactatt
gccatggtggagaagtattttaacggtatggtgcaggcgcccacggaaaaagaagaaata
gacgaagatttacggcaattggccatggttactgtagaagattaccgtaaccaaatggaa
aaattagaattaagcaatgctctggccagtatatggaaattaattggccgtgctaataag
tatattgatgaaacggctccctggattctggccaaggatgaggcgaagcggcccagattg
ggtacggttttatataacctgttggaagtaatccggatagtcactgtcctcgtatcccct
tttatgaccaggcttccggacaaggtttgggttcaatgtgggcttagcggaaaagaggaa
tgtaccacgtgggaatctgtccagaattgggggcggttccctgccgatattaatgtgaag
cggggggaagccctgttccccagaattgaggtaaaaaaggagcgggaagctgtggaggaa
aaggataacactgctatacaggctgcaaccaaggaggagcctgccggggaaaaacagtat
attaccattgaagagtttgccagaattgatttgcgtctggcggaaatagttaaggcagaa
aaagtggaaaaggctgacaagttagttaagctggaggtggctttgggcgaggagcgccgt
actatagttgccggtatagcccaacattacagccccgatgaactgataggcaaaaagata
gtggtggtggcaaatctcaagcctgccaaattgagaggaattttgtccgaaggtatgctg
ctggcggcatcccatgacgggaaccttggtgtgcttaccattgatccgggaaaagaagtg
cccagtggcgcgaaggttaaataa

DBGET integrated database retrieval system