KEGG   Thermincola potens: TherJR_0753Help
Entry
TherJR_0753       CDS       T01226                                 

Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
tjr  Thermincola potens
Pathway
tjr00450  Selenocompound metabolism
tjr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    TherJR_0753
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tjr03016]
    TherJR_0753
Enzymes [BR:tjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     TherJR_0753
Transfer RNA biogenesis [BR:tjr03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    TherJR_0753
 Prokaryotic type
    TherJR_0753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ADG81620
UniProt: D5XCJ4
Position
744232..745188
Genome map
AA seq 318 aa AA seqDB search
MPSTGKDPNLLVGLDTSDDAGVYKLTDDIALIQTLDFFTPVVDNPYDFGRIAAANALSDV
YAMGGKPLTAMNLVGFPTETLGLEILAEILRGGAEKVCEAGAVLLGGHSVEDKEPKYGLS
VTGIIHPDRVLTNAAAKPGDVLVLTKPLGIGIITTALKAGMASEEAEREATAVMSALNKD
AAEIMQEVGAHACTDVTGFGLLGHALELAKASSVNVRIFAAEVPVLAPAREYVRYGLIPA
GTRRNLKYVAQFTRFDDNLEEEERIILADTITSGGLLISLPEEKAARYMELSREKGLNAA
IIGEVIPGKGNLEVYKES
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgccgtcaactggaaaagaccctaatttactggtagggcttgacacctccgacgatgcc
ggggtttataagcttaccgatgatattgccttgattcagactctggatttctttacgcct
gttgtagacaacccctatgacttcgggcgaattgccgccgctaacgccctcagcgatgta
tatgccatggggggaaagccgctcacggccatgaacctggttgggtttccgactgagacc
ctgggcttggaaatactggcggaaattttacggggtggcgctgaaaaggtatgtgaagca
ggcgctgtactactgggcgggcattccgtcgaagataaagaacccaaatacggtttatcc
gtaaccgggattatccatccggaccgggttctgaccaatgcagcggcaaaaccgggagac
gtgcttgttttaactaaaccgctgggcatcggtatcattaccactgccctgaaagcaggc
atggcttctgaagaggcggagagggaagctacggcagtcatgagcgctttaaataaggat
gccgcagaaatcatgcaggaagtgggcgcccatgcctgtacagatgtaacgggattcggt
cttctgggccatgctctggaattggctaaagcgagctcggtaaatgtaaggatttttgct
gcagaggtgccggtcctggccccggcccgggaatatgtacgctatggcttgattcctgcc
ggtacaagaagaaacctgaaatatgttgctcagtttacccgatttgacgacaacctggag
gaagaagaaaggattatactggcagataccattacttccggaggcctactcatttcgctg
ccggaagaaaaagctgcccgttatatggagcttagccgtgaaaaggggctgaatgctgcc
ataataggtgaagtcatccccgggaagggaaatcttgaagtatacaaggagagttag

DBGET integrated database retrieval system