KEGG   Thermincola potens: TherJR_1099Help
Entry
TherJR_1099       CDS       T01226                                 

Definition
(GenBank) Acetamidase/Formamidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
tjr  Thermincola potens
Pathway
tjr00330  Arginine and proline metabolism
tjr00360  Phenylalanine metabolism
tjr00627  Aminobenzoate degradation
tjr00643  Styrene degradation
tjr01100  Metabolic pathways
tjr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tjr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    TherJR_1099
   00360 Phenylalanine metabolism
    TherJR_1099
   00380 Tryptophan metabolism
    TherJR_1099
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TherJR_1099
   00643 Styrene degradation
    TherJR_1099
Enzymes [BR:tjr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     TherJR_1099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FmdA_AmdA TraH_2
Motif
Other DBs
NCBI-ProteinID: ADG81963
UniProt: D5XE92
Position
1152366..1153271
Genome map
AA seq 301 aa AA seqDB search
MKIRADKVIYGFNPDLEAVAVARSGDVIVFETLDCFANQIVEAEQSVDNIDWEQINPATG
PVYIKDARPGDSIRVSILKIDLADRGVMAAIPDCGVLGNRVKEPEIKILPIKGSTAYFND
IALPVKPMVGVIGVAPASGEIPCGIPGAHGGNLDTNLICAGNDLILPVAVPGALLALGDV
HARMGDGEVWVTGIEAAAQVTVRVEVLKNFSVKEPVVMNDEITAFLSSAATLDEAVTKVT
EYAVDCLVKLGLSFNDAGMLLSAVGDLQISQVVDPLKTVRLVVPRWILTRYGFNPDRLKS
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagagcagataaagtaatttacgggtttaaccctgatttggaggcggttgcc
gttgcccggtcgggggacgtgatcgtatttgaaaccttggattgttttgccaaccagata
gttgaggccgaacaatcggttgataatatcgactgggaacagattaaccccgccaccggc
ccggtttatataaaagatgcccggcctggtgacagcatccgggtgagtattttgaaaata
gacctggctgaccggggggttatggctgccattcctgattgcggtgtgctgggtaacagg
gtaaaagagccggaaatcaaaattcttcccattaagggcagtaccgcttattttaatgat
attgcgctgccggtaaaaccgatggtgggtgttatcggcgtggcgccggcgtccggtgaa
ataccttgtggcatacccggggcccacggcggaaatctggataccaaccttatttgtgct
ggcaacgaccttattttaccggtggctgtaccaggcgccttgttggctttgggtgatgtc
cacgcgcgtatgggagacggagaagtatgggttaccggtattgaggcggcagcgcaagtt
acggtaagggtagaggtgctgaaaaacttttccgttaaagaacccgttgttatgaatgac
gaaattacagcgttcctaagctcagcggcaacactggatgaggctgtgacaaaagtgacc
gagtatgccgttgactgcctggtgaagctggggttatcttttaatgatgccggtatgctc
ttaagcgctgttggagacttacaaatatcgcaggttgtagatccgttaaaaacagtacgc
ttggttgtcccccgctggattttaaccagatatggatttaacccggaccggctgaaaagc
ctttaa

DBGET integrated database retrieval system